DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nes and MBOAT1

DIOPT Version :9

Sequence 1:NP_524157.2 Gene:nes / 40093 FlyBaseID:FBgn0026630 Length:497 Species:Drosophila melanogaster
Sequence 2:NP_001073949.1 Gene:MBOAT1 / 154141 HGNCID:21579 Length:495 Species:Homo sapiens


Alignment Length:467 Identity:107/467 - (22%)
Similarity:193/467 - (41%) Gaps:77/467 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 VGVPVEALRLLLTILAGYPVAALYQKFISV-IADKTVHHMFFAGCGAGLCYFNYGLDTYHSLIAI 84
            :|:|::.:..::..|.....|..::.::.. .....|.|......|.....|.:|..:.|..:.:
Human    27 LGIPLDQVNFVVCQLVALFAAFWFRIYLRPGTTSSDVRHAVATIFGIYFVIFCFGWYSVHLFVLV 91

  Fly    85 LTTYFLVLLLR----KKTQIFLAINF--VFHMSYLLLGYFYTSSNDYDILWTMPHCILVLRMIGY 143
            |..|.:::...    .:...|:|:.:  :.|:|.:.:.::...:.|:    :.|..|:..::...
Human    92 LMCYAIMVTASVSNIHRYSFFVAMGYLTICHISRIYIFHYGILTTDF----SGPLMIVTQKITTL 152

  Fly   144 GFDITDGLKEESE-LSKDQKETALKKPPSLLELLAFSYFPSGFLVGPQFPFRRYKAFVDGEFRQH 207
            .|.:.|||...:| ||.:|...|:|..||.||.|::.......:.||...|:.|.||::|: ..|
Human   153 AFQVHDGLGRRAEDLSAEQHRLAIKVKPSFLEYLSYLLNFMSVIAGPCNNFKDYIAFIEGK-HIH 216

  Fly   208 EGNVEAGVRRFG---------AGAFYLIVCQVGLRYLPDSYFLT-----PEFAQV--------SF 250
            ...:|...:|.|         .||   ::.::|:..:....|||     |....|        ||
Human   217 MKLLEVNWKRKGFHSLPEPSPTGA---VIHKLGITLVSLLLFLTLTKTFPVTCLVDDWFVHKASF 278

  Fly   251 VKRIYLLGFWAKFSLYKYISCWLLTEGALICIGLTYKGEDKNGQPDWSGCSNVKLKLLETGNTME 315
            ..|:..|....:.|..||...|.|.:......|..:.|.||||...|...||:.:..:||..:.:
Human   279 PARLCYLYVVMQASKPKYYFAWTLADAVNNAAGFGFSGVDKNGNFCWDLLSNLNIWKIETATSFK 343

  Fly   316 HYVQSFNVNTNQWVGQYIYKRLKFLNNRTISYGAALGFL--AVWHGYHSGYYMTFLMEYMVVSTE 378
            .|::::|:.|..|:....|:|:.:       |...|.|:  |:|||.:.|||.|||...:|....
Human   344 MYLENWNIQTATWLKCVCYQRVPW-------YPTVLTFILSALWHGVYPGYYFTFLTGILVTLAA 401

  Fly   379 KQITRFYTKVVLPQWGHILNNSDIYKLLYFITLKSYNVVYMG--WCLT---------AFVFLKYE 432
            :.:...|..                   ||::.::...||..  |.:|         .||.|..|
Human   402 RAVRNNYRH-------------------YFLSSRALKAVYDAGTWAVTQLAVSYTVAPFVMLAVE 447

  Fly   433 RWIVVYGAVSYY 444
            ..|.:|.::.:|
Human   448 PTISLYKSMYFY 459

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nesNP_524157.2 MBOAT 114..421 CDD:281107 82/333 (25%)
MBOAT1NP_001073949.1 MBOAT 22..458 CDD:294479 106/464 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5202
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54526
OrthoDB 1 1.010 - - D881262at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.830

Return to query results.
Submit another query.