DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CHCHD10 and Chchd2

DIOPT Version :9

Sequence 1:NP_001288268.1 Gene:CHCHD10 / 400916 HGNCID:15559 Length:149 Species:Homo sapiens
Sequence 2:NP_573196.1 Gene:Chchd2 / 32701 FlyBaseID:FBgn0260747 Length:170 Species:Drosophila melanogaster


Alignment Length:175 Identity:77/175 - (44%)
Similarity:95/175 - (54%) Gaps:36/175 - (20%)


- Green bases have known domain annotations that are detailed below.


Human     1 MPRGSRSAASRPASRPAAP-SAHPPA---------HPPPSAAAPAPAPSG------------QPG 43
            |.|..|||:..|::|..|| .|..||         .|.|:|:||.|||..            ||.
  Fly     1 MVRRGRSASPPPSTRRTAPVQARAPAPAPAPVQTRAPAPAASAPVPAPMSAPPSAVGMPAPQQPS 65

Human    44 LMAQMATTAAGVAVGSAVGHVMGSALTGAFSG-GSSE-------PSQPAVQQPLALYPQAPTPAA 100
            :..|||.||.|||||||:||.:|..||..||| |..|       .:.||.|||  .|.|...|..
  Fly    66 MFQQMAATAGGVAVGSAIGHTVGHGLTSLFSGSGDKEAAAPAPAAAAPAPQQP--YYAQQQQPNE 128

Human   101 PQPLQMGPCAYEIRQFLDCSTTQSDLSLCEGFSEALKQCKYYHGL 145
            ||    |.||:|::||:.|:..|:||:|||||:|||:|||..|.|
  Fly   129 PQ----GACAWELKQFIQCAQGQADLTLCEGFNEALRQCKQSHHL 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CHCHD10NP_001288268.1 DUF2076 <40..>88 CDD:331414 27/67 (40%)
CHCH 109..140 CDD:310983 18/30 (60%)
Chchd2NP_573196.1 CHCH 133..165 CDD:284221 19/31 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4090
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 138 1.000 Inparanoid score I4528
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54220
OrthoDB 1 1.010 - - D1611117at2759
OrthoFinder 1 1.000 - - FOG0001898
OrthoInspector 1 1.000 - - otm41009
orthoMCL 1 0.900 - - OOG6_103181
Panther 1 1.100 - - LDO PTHR13523
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2188
SonicParanoid 1 1.000 - - X1616
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1211.870

Return to query results.
Submit another query.