DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL21 and MRPL49

DIOPT Version :9

Sequence 1:NP_001262039.1 Gene:mRpL21 / 40091 FlyBaseID:FBgn0036853 Length:201 Species:Drosophila melanogaster
Sequence 2:NP_012439.2 Gene:MRPL49 / 853349 SGDID:S000003632 Length:161 Species:Saccharomyces cerevisiae


Alignment Length:169 Identity:45/169 - (26%)
Similarity:72/169 - (42%) Gaps:33/169 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 PNRSLLTAGAMRPLSISPVIGQQNKPATESVDLSAIAKDQQKECLSICERINRQVQKSEQGRLFA 80
            |.|:|.|:.     |||....:..|..|..:.||                          ..|:|
Yeast    24 PFRNLATSS-----SISSTKAKTTKTDTTPLKLS--------------------------NELYA 57

  Fly    81 VVHLCGKQFKVTPGD-IILVEGYWPPTIGDEISLDKVLLAGARDFTLVGRPILEPGLILVKATVV 144
            :..:..:.:.||.|| :||........:||.:::..|...|:|::.|||.|| ...|..:|||||
Yeast    58 IFKIHNRPYLVTEGDRVILPFKLKQAEVGDILNMTDVTTLGSRNYKLVGHPI-NTSLYTLKATVV 121

  Fly   145 EKTLSHTKTHFRKKRRKQYMRINFQRSPHTMVRINSIEL 183
            .||....:|....|||.:.:|....:...|::||:.:.:
Yeast   122 GKTKRAFQTREVTKRRNRRVRHAKSKGDLTILRISELSM 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL21NP_001262039.1 Ribosomal_L21p 85..175 CDD:279202 29/90 (32%)
MRPL49NP_012439.2 Ribosomal_L21p 56..157 CDD:395667 33/101 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 47 1.000 Domainoid score I3051
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 50 1.000 Inparanoid score I1845
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004347
OrthoInspector 1 1.000 - - oto100316
orthoMCL 1 0.900 - - OOG6_101040
Panther 1 1.100 - - LDO PTHR21349
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4012
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.990

Return to query results.
Submit another query.