DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL21 and RPL21C

DIOPT Version :9

Sequence 1:NP_001262039.1 Gene:mRpL21 / 40091 FlyBaseID:FBgn0036853 Length:201 Species:Drosophila melanogaster
Sequence 2:NP_174808.1 Gene:RPL21C / 840472 AraportID:AT1G35680 Length:220 Species:Arabidopsis thaliana


Alignment Length:162 Identity:44/162 - (27%)
Similarity:77/162 - (47%) Gaps:13/162 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 TAGAMR-PLSISPVIGQQNKPA-TESVDLSAIAKDQQKECLSICERINRQVQKSEQGRLFAVVHL 84
            ||...| ..:::|...:....| .|:.|:.|:......|...         :|:::..:|||:.:
plant    51 TASTSRTAFTVAPKFAESVVEAEPETTDIEAVVVSDVSEVTE---------EKAKREEIFAVIMV 106

  Fly    85 CGKQFKVTPGDIILVEGYWPPTIGDEISLDKVLLAGARDFTLVGRPILEPGLILVKATVVEKTLS 149
            .|:|:.|.||..:..:......:.|:|.|:||||.|.:..|.:|:|::...  .|.|.|..:.|:
plant   107 GGRQYIVFPGRYLYTQRLKDANVDDQIVLNKVLLVGTKTHTYIGKPVVTNA--TVHAVVESQGLN 169

  Fly   150 HTKTHFRKKRRKQYMRINFQRSPHTMVRINSI 181
            .....|:.|.:|:|.|....|.|:|.:||..|
plant   170 DKVVVFKYKPKKKYRRNIGHRQPNTRIRITGI 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL21NP_001262039.1 Ribosomal_L21p 85..175 CDD:279202 27/89 (30%)
RPL21CNP_174808.1 rplU 101..203 CDD:235510 34/103 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 67 1.000 Domainoid score I3526
eggNOG 1 0.900 - - E1_COG0261
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG56622
OrthoDB 1 1.010 - - D1586807at2759
OrthoFinder 1 1.000 - - FOG0004347
OrthoInspector 1 1.000 - - otm3454
orthoMCL 1 0.900 - - OOG6_101040
Panther 1 1.100 - - O PTHR21349
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1110.790

Return to query results.
Submit another query.