DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL21 and NFD1

DIOPT Version :9

Sequence 1:NP_001262039.1 Gene:mRpL21 / 40091 FlyBaseID:FBgn0036853 Length:201 Species:Drosophila melanogaster
Sequence 2:NP_567861.1 Gene:NFD1 / 829217 AraportID:AT4G30930 Length:270 Species:Arabidopsis thaliana


Alignment Length:155 Identity:51/155 - (32%)
Similarity:73/155 - (47%) Gaps:11/155 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 QQNKPATESVDLSAIAKDQQKECLSICERINRQV----QKSEQ-----GRLFAVVHLCGKQFKVT 92
            ::.:...:|.|:....:....|.:...|.|..:|    :.||:     ..:||:|.:...||||:
plant    90 EEGEDFEDSADMEVEREYSPAEKVEEAEEIGYKVMGPLKPSERLFKPYEPVFAIVQIGSHQFKVS 154

  Fly    93 PGDIILVEGYWPPTIGDEISLDKVLLAGARDFTLVGRPILEPGLILVKATVVEKTLSHTKTHFRK 157
            .||.|..|......|.|::.|.||||.|:...|::|||||...  .|.|.|.|..|......|:|
plant   155 NGDSIFTEKLKFCDINDKLELTKVLLLGSASQTIIGRPILPDA--TVHAVVEEHALDEKVLIFKK 217

  Fly   158 KRRKQYMRINFQRSPHTMVRINSIE 182
            ||||.|.|....|...|.:||..|:
plant   218 KRRKNYRRTRGHRQELTKLRITDIQ 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL21NP_001262039.1 Ribosomal_L21p 85..175 CDD:279202 36/89 (40%)
NFD1NP_567861.1 rplU 141..243 CDD:235510 43/104 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 67 1.000 Domainoid score I3526
eggNOG 1 0.900 - - E1_COG0261
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1586807at2759
OrthoFinder 1 1.000 - - FOG0004347
OrthoInspector 1 1.000 - - otm3454
orthoMCL 1 0.900 - - OOG6_101040
Panther 1 1.100 - - LDO PTHR21349
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
98.780

Return to query results.
Submit another query.