DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL21 and Mrpl21

DIOPT Version :9

Sequence 1:NP_001262039.1 Gene:mRpL21 / 40091 FlyBaseID:FBgn0036853 Length:201 Species:Drosophila melanogaster
Sequence 2:XP_038935203.1 Gene:Mrpl21 / 309140 RGDID:1310203 Length:238 Species:Rattus norvegicus


Alignment Length:182 Identity:61/182 - (33%)
Similarity:98/182 - (53%) Gaps:19/182 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 FLAQTMRQMLRHVPNRSLLTAGAMRPLSISPVIGQQNKPATESVDLSAIAKDQQKECLSICERIN 67
            |.:|:......:||..||                  :.|..:.|.|...|::.:... .:.:::|
  Rat    72 FNSQSASYPQGYVPKTSL------------------SSPPWQEVVLPDPAEETRHHA-EVVKKVN 117

  Fly    68 RQVQKSEQGRLFAVVHLCGKQFKVTPGDIILVEGYWPPTIGDEISLDKVLLAGARDFTLVGRPIL 132
            ..:...:.||||||||....|:|||..|:||:|.......|:.|.|:||||.|..:|||:|:|:|
  Rat   118 ELIAAGQYGRLFAVVHFASHQWKVTAEDLILIENELDIKCGERIRLEKVLLVGTDNFTLLGKPLL 182

  Fly   133 EPGLILVKATVVEKTLSHTKTHFRKKRRKQYMRINFQRSPHTMVRINSIELA 184
            ...|:.|:|||:|||.|..|.:.:.::||.:.:.....:|.|::|||:||:|
  Rat   183 GKDLVRVEATVIEKTESWPKINMKFRKRKNFRKKKIIVNPQTILRINTIEIA 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL21NP_001262039.1 Ribosomal_L21p 85..175 CDD:279202 35/89 (39%)
Mrpl21XP_038935203.1 Ribosomal_L21p 129..231 CDD:395667 44/101 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166340993
Domainoid 1 1.000 87 1.000 Domainoid score I7850
eggNOG 1 0.900 - - E1_COG0261
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H32936
Inparanoid 1 1.050 103 1.000 Inparanoid score I4863
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1586807at2759
OrthoFinder 1 1.000 - - FOG0004347
OrthoInspector 1 1.000 - - oto98731
orthoMCL 1 0.900 - - OOG6_101040
Panther 1 1.100 - - LDO PTHR21349
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X5441
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1514.760

Return to query results.
Submit another query.