DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL21 and MRPL21

DIOPT Version :9

Sequence 1:NP_001262039.1 Gene:mRpL21 / 40091 FlyBaseID:FBgn0036853 Length:201 Species:Drosophila melanogaster
Sequence 2:XP_005273880.1 Gene:MRPL21 / 219927 HGNCID:14479 Length:280 Species:Homo sapiens


Alignment Length:183 Identity:55/183 - (30%)
Similarity:92/183 - (50%) Gaps:24/183 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 FLAQTMRQMLRHVPNRSLLTAGAMRPLSISPVIGQQNKPATESVDLSAIAKDQQKECLSICERIN 67
            |.:|:...:..:||..||.:......:...||                   ::.:....:.:::|
Human    39 FNSQSTSYLPGYVPKTSLSSPPWPEVVLPDPV-------------------EETRHHAEVVKKVN 84

  Fly    68 RQVQKSEQGRLFAVVHLCGKQFKVTPGDIILVEGYWPPTIGDEISLDKVLLAGARDFTLVGRPIL 132
            ..:...:.||||||||...:|:|||..|:||:........|:.|.|:||||.||.:|||:|:|:|
Human    85 EMIVTGQYGRLFAVVHFASRQWKVTSEDLILIGNELDLACGERIRLEKVLLVGADNFTLLGKPLL 149

  Fly   133 EPGLILVKATVVEKTLSHTKTHFRKKRRKQYMRINFQRSPHTMVRINSIELAR 185
            ...|:.|:|||:|||.|..:...|.::||     ||::....:.::....:||
Human   150 GKDLVRVEATVIEKTESWPRIIMRFRKRK-----NFKKKRSKLEKVPLGPVAR 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL21NP_001262039.1 Ribosomal_L21p 85..175 CDD:279202 36/89 (40%)
MRPL21XP_005273880.1 Ribosomal_L21p 102..179 CDD:279202 34/81 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165147341
Domainoid 1 1.000 89 1.000 Domainoid score I7898
eggNOG 1 0.900 - - E1_COG0261
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H32936
Inparanoid 1 1.050 104 1.000 Inparanoid score I4953
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004347
OrthoInspector 1 1.000 - - oto91660
orthoMCL 1 0.900 - - OOG6_101040
Panther 1 1.100 - - LDO PTHR21349
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X5441
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1312.750

Return to query results.
Submit another query.