DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fz2 and Sfrp1

DIOPT Version :10

Sequence 1:NP_001401042.1 Gene:fz2 / 40090 FlyBaseID:FBgn0016797 Length:826 Species:Drosophila melanogaster
Sequence 2:NP_001263641.2 Gene:Sfrp1 / 84402 RGDID:621074 Length:314 Species:Rattus norvegicus


Alignment Length:133 Identity:47/133 - (35%)
Similarity:70/133 - (52%) Gaps:13/133 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 KDPNLRCEEITIP--MCRGIGYNMTSFPNEMNHETQDEAGLEVHQFWPLVEIKCSPDLKFFLCSM 120
            |.|  :|.:|.:.  :|..:||.....||.:.|||..|...:...:.||:...|....:.||||:
  Rat    54 KPP--QCVDIPVDLRLCHNVGYKKMVLPNLLEHETMAEVKQQASSWVPLLNKNCHMGTQVFLCSL 116

  Fly   121 YTPICLEDYHKPLPVCRSVCERARSGCAPIMQQYSFEWPERMACEHLPLHGDPDNLC--MEQPSY 183
            :.|:||:   :|:..||.:||..|..|.|:||.:.|.|||.:.|:..| .||   :|  |..|:.
  Rat   117 FAPVCLD---RPIYPCRWLCEAVRDSCEPVMQFFGFYWPEMLKCDKFP-EGD---VCIAMTPPNA 174

  Fly   184 TEA 186
            |||
  Rat   175 TEA 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fz2NP_001401042.1 CRD_FZ5_like 63..182 CDD:143565 41/122 (34%)
7tmF_FZD5_FZD8-like 307..618 CDD:320163
TM helix 1 316..341 CDD:320163
TM helix 2 350..371 CDD:320163
TM helix 3 396..422 CDD:320163
TM helix 4 439..455 CDD:320163
TM helix 5 477..506 CDD:320163
TM helix 6 531..558 CDD:320163
TM helix 7 579..604 CDD:320163
Sfrp1NP_001263641.2 CRD_SFRP1 52..175 CDD:143552 44/129 (34%)
NTR_Sfrp1_like 183..306 CDD:239635
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.