DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fz2 and MFRP

DIOPT Version :9

Sequence 1:NP_001262037.1 Gene:fz2 / 40090 FlyBaseID:FBgn0016797 Length:806 Species:Drosophila melanogaster
Sequence 2:NP_113621.1 Gene:MFRP / 83552 HGNCID:18121 Length:579 Species:Homo sapiens


Alignment Length:205 Identity:53/205 - (25%)
Similarity:69/205 - (33%) Gaps:51/205 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 LLLTSCRADGPLH------------SADHGMGGMGM--------------GGHGLDASPAPGYGV 53
            ||...|.|:.|.|            ..|||:...|.              |...|........||
Human   372 LLGRFCGAEPPPHLVSSHHELAVLFRTDHGISSGGFSATYLAFNATENPCGPSELSCQAGGCKGV 436

  Fly    54 --------------------PVIPKDPNLRCEEITIPMCRGIGYNMTSFPN-EMNHETQDEAGLE 97
                                |:.| .|.|.||.:.:.||.|:.||.|:||| .:...||:|....
Human   437 QWMCDMWRDCTDGSDDNCSGPLFP-PPELACEPVQVEMCLGLSYNTTAFPNIWVGMITQEEVVEV 500

  Fly    98 VHQFWPLVEIKCSPDLKFFLCSMYTPICLEDYHKPLPVCRSVCERARSGCAPIMQQYSFEWPERM 162
            :..:..|..:.|....:..||.:..|.| ......||.|||||:.|...|...:......||  .
Human   501 LSGYKSLTSLPCYQHFRRLLCGLLVPRC-TPLGSVLPPCRSVCQEAEHQCQSGLALLGTPWP--F 562

  Fly   163 ACEHLPLHGD 172
            .|..||...|
Human   563 NCNRLPEAAD 572

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fz2NP_001262037.1 CRD_FZ5_like 63..182 CDD:143565 35/111 (32%)
Frizzled 308..618 CDD:279827
MFRPNP_113621.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 100..143
CUB 144..252 CDD:238001
LDLa 260..294 CDD:238060
CUB 301..411 CDD:238001 10/38 (26%)
LDLa 421..454 CDD:238060 4/32 (13%)
Fz 466..569 CDD:279700 33/105 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3577
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.