Sequence 1: | NP_001262037.1 | Gene: | fz2 / 40090 | FlyBaseID: | FBgn0016797 | Length: | 806 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_113621.1 | Gene: | MFRP / 83552 | HGNCID: | 18121 | Length: | 579 | Species: | Homo sapiens |
Alignment Length: | 205 | Identity: | 53/205 - (25%) |
---|---|---|---|
Similarity: | 69/205 - (33%) | Gaps: | 51/205 - (24%) |
- Green bases have known domain annotations that are detailed below.
Fly 15 LLLTSCRADGPLH------------SADHGMGGMGM--------------GGHGLDASPAPGYGV 53
Fly 54 --------------------PVIPKDPNLRCEEITIPMCRGIGYNMTSFPN-EMNHETQDEAGLE 97
Fly 98 VHQFWPLVEIKCSPDLKFFLCSMYTPICLEDYHKPLPVCRSVCERARSGCAPIMQQYSFEWPERM 162
Fly 163 ACEHLPLHGD 172 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
fz2 | NP_001262037.1 | CRD_FZ5_like | 63..182 | CDD:143565 | 35/111 (32%) |
Frizzled | 308..618 | CDD:279827 | |||
MFRP | NP_113621.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 100..143 | ||
CUB | 144..252 | CDD:238001 | |||
LDLa | 260..294 | CDD:238060 | |||
CUB | 301..411 | CDD:238001 | 10/38 (26%) | ||
LDLa | 421..454 | CDD:238060 | 4/32 (13%) | ||
Fz | 466..569 | CDD:279700 | 33/105 (31%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3577 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |