DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fz2 and sfrp1b

DIOPT Version :9

Sequence 1:NP_001262037.1 Gene:fz2 / 40090 FlyBaseID:FBgn0016797 Length:806 Species:Drosophila melanogaster
Sequence 2:NP_001077040.1 Gene:sfrp1b / 798564 ZFINID:ZDB-GENE-061103-1 Length:300 Species:Danio rerio


Alignment Length:156 Identity:52/156 - (33%)
Similarity:77/156 - (49%) Gaps:13/156 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 LDASPAPGYGVPVIPKDPNLRCEEI--TIPMCRGIGYNMTSFPNEMNHETQDEAGLEVHQFWPLV 105
            |:|.....|..|....|.:..|.:|  .:.:|..:||.....||.::|||..|...:...:.|||
Zfish    21 LNALEDEDYIWPPDSSDKHPPCVDIPEDLRLCFNVGYGRMMLPNLLDHETIAEVKQQAVSWVPLV 85

  Fly   106 EIKCSPDLKFFLCSMYTPICLEDYHKPLPVCRSVCERARSGCAPIMQQYSFEWPERMACEHLPLH 170
            ...|....:..|||::.|:||:   :||..||..||..|..||||||.:.|.|||.:.|:..|| 
Zfish    86 HKACHKGTQVLLCSLFAPVCLD---RPLYPCRWFCEAVRDSCAPIMQAFGFPWPEMLRCDKFPL- 146

  Fly   171 GDPDNLCME----QPSYTEAGSGGSS 192
               ..:|:.    :.:.|:..:||||
Zfish   147 ---GEVCISSNATKSNETDLIAGGSS 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fz2NP_001262037.1 CRD_FZ5_like 63..182 CDD:143565 42/124 (34%)
Frizzled 308..618 CDD:279827
sfrp1bNP_001077040.1 CRD_SFRP1 36..159 CDD:143552 43/129 (33%)
NTR_Sfrp1_like 170..292 CDD:239635 52/156 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3577
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.