DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fz2 and Fzd4

DIOPT Version :9

Sequence 1:NP_001262037.1 Gene:fz2 / 40090 FlyBaseID:FBgn0016797 Length:806 Species:Drosophila melanogaster
Sequence 2:NP_072145.1 Gene:Fzd4 / 64558 RGDID:71017 Length:538 Species:Rattus norvegicus


Alignment Length:633 Identity:237/633 - (37%)
Similarity:326/633 - (51%) Gaps:151/633 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 RLKVLILGLVLLLTSCRADGPLHSADHGMGGMGMGGHGLDASPAPGYGVPVIPKDPNLRCEEITI 69
            ||.:|:|.|:||                            ..||.|:|     .:...||:.|.|
  Rat    20 RLGLLLLQLLLL----------------------------QRPALGFG-----DEEERRCDPIRI 51

  Fly    70 PMCRGIGYNMTSFPNEMNHETQDEAGLEVHQFWPLVEIKCSPDLKFFLCSMYTPICLEDYHKPLP 134
            .||:.:|||:|..||.:.||.|.:|.|::..|.||::..||..|:|||||:|.|:|.|..:.|:.
  Rat    52 AMCQNLGYNVTKMPNLVGHELQTDAELQLTTFTPLIQYGCSSQLQFFLCSVYVPMCTEKINIPIG 116

  Fly   135 VCRSVCERARSGCAPIMQQYSFEWPERMACEHLPLHGDPDNLCMEQPSYTEAGSGGSSGGSGGSG 199
            .|..:|...:..|.|:::::.|.||:.:.|...|...|.:::|||.|...|.             
  Rat   117 PCGGMCLSVKRRCEPVLKEFGFAWPDSLNCSKFPPQNDHNHMCMEGPGDEEV------------- 168

  Fly   200 SGSGSGGKRKQGGSGSGGSGAGGSSGSTSTKPCRGRNSKNCQNPQGEKA---SGKEC-SCSCRSP 260
                                                       |...|.   .|:|| |....|.
  Rat   169 -------------------------------------------PLPHKTPIQPGEECHSVGTNSD 190

  Fly   261 LIFLGKEQLLQQQSQMPMMHHPHHWYMNLTVQRIAGVPNCGIPC--KGPFFSNDEKDFAGLWIAL 323
            .....|..|                             ||.:.|  ....:|...|:|..:|:|:
  Rat   191 QYIWVKRSL-----------------------------NCVLKCGYDAGLYSRSAKEFTDIWMAV 226

  Fly   324 WSGLCFCSTLMTLTTFIIDTERFKYPERPIVFLSACYFMVAVGYLSRNFLQNEEIACD------G 382
            |:.|||.||..|:.||:||:.||.||||||:|||.||.:.::.|:.|..:..|.|:||      .
  Rat   227 WASLCFISTTFTVLTFLIDSSRFSYPERPIIFLSMCYNIYSIAYIVRLTVGRERISCDFEEAAEP 291

  Fly   383 LLLRE--SSTGPHSCTLVFLLTYFFGMASSIWWVILSFTWFLAAGLKWGNEAITKHSQYFHLAAW 445
            :|::|  .:||   |.::|||.||||||||||||||:.|||||||||||:|||..||.|||:|||
  Rat   292 VLIQEGLKNTG---CAIIFLLMYFFGMASSIWWVILTLTWFLAAGLKWGHEAIEMHSSYFHIAAW 353

  Fly   446 LIPTVQSVAVLLLSAVDGDPILGICYVGNLNPDHLKTFVLAPLFVYLVIGTTFLMAGFVSLFRIR 510
            .||.|:::.:|::..||.|.:.|:|||||.:.|.|..||:||||.||||||.|:.||.|:||:||
  Rat   354 AIPAVKTIVILIMRLVDADELTGLCYVGNQSLDALTGFVVAPLFTYLVIGTLFIAAGLVALFKIR 418

  Fly   511 SVIKQQGGVGAGVKADKLEKLMIRIGIFSVLYTVPATIVIGCYLYEAAYFEDWIKALACPCAQVK 575
            |.:::.     |.|.||||:||::||:||||||||||.||.||.||   ..:|        |..:
  Rat   419 SNLQKD-----GTKTDKLERLMVKIGVFSVLYTVPATCVIACYFYE---ISNW--------ALFR 467

  Fly   576 GPGKKPLYSVLMLKYFMALAVGITSGVWIWSGKTLESWRRFWRRLLGA 623
            ........:|.|||.||:|.||||||:||||.|||.:|::...||:.:
  Rat   468 YSADDSNMAVEMLKIFMSLLVGITSGMWIWSAKTLHTWQKCSNRLVNS 515

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fz2NP_001262037.1 CRD_FZ5_like 63..182 CDD:143565 46/118 (39%)
Frizzled 308..618 CDD:279827 164/317 (52%)
Fzd4NP_072145.1 CRD_FZ4 43..168 CDD:143557 47/124 (38%)
Frizzled 211..510 CDD:279827 164/317 (52%)
Lys-Thr-X-X-X-Trp motif, mediates interaction with the PDZ domain of Dvl family members. /evidence=ECO:0000250 500..505 3/4 (75%)
PDZ-binding 536..538
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3577
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D237456at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.