DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fz2 and Fzd2

DIOPT Version :9

Sequence 1:NP_001262037.1 Gene:fz2 / 40090 FlyBaseID:FBgn0016797 Length:806 Species:Drosophila melanogaster
Sequence 2:NP_742032.2 Gene:Fzd2 / 64512 RGDID:71012 Length:570 Species:Rattus norvegicus


Alignment Length:639 Identity:281/639 - (43%)
Similarity:370/639 - (57%) Gaps:120/639 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LILGLVLLLTSCRADGPLHSADHGMGGMGMGGHGLDASPAPGYGVPVIPKDPNLRCEEITIPMCR 73
            |:|.|:||    .|.||  :..||..|:.:..||.                    |:.|:||:|.
  Rat    15 LLLPLLLL----PAAGP--AQFHGEKGISIPDHGF--------------------CQPISIPLCT 53

  Fly    74 GIGYNMTSFPNEMNHETQDEAGLEVHQFWPLVEIKCSPDLKFFLCSMYTPIC--LEDYHKPLPVC 136
            .|.||.|..||.:.|..|::||||||||:|||:::|||:|:|||||||.|:|  ||   :.:|.|
  Rat    54 DIAYNQTIMPNLLGHTNQEDAGLEVHQFYPLVKVQCSPELRFFLCSMYAPVCTVLE---QAIPPC 115

  Fly   137 RSVCERARSGCAPIMQQYSFEWPERMACEHLPLHGDPDNLCMEQPSYTEAGSGGSSGGSGGSGSG 201
            ||:|||||.||..:|.::.|:||||:.|||.|.|| .:.:|:.| :::|.|:......:..||..
  Rat   116 RSICERARQGCEALMNKFGFQWPERLRCEHFPRHG-AEQICVGQ-NHSEDGTPALLTTAPPSGLQ 178

  Fly   202 SGSGGKRKQGGSGSGGSGAGGSSGSTSTKPCRGRNSKNCQNPQGEKASGKECSCSCRSPLIFLGK 266
            .|:||.       .||.|.||:....:|                                     
  Rat   179 PGAGGT-------PGGPGGGGAPPRYAT------------------------------------- 199

  Fly   267 EQLLQQQSQMPMMHHPHHWYMNLTV-----QRIAGVPNCGIPCK------GPFFSNDEKDFAGLW 320
                        :.||.|....|.|     .:..|..:|..||:      ..|||.:|..||.||
  Rat   200 ------------LEHPFHCPRVLKVPSYLSYKFLGERDCAAPCEPARPDGSMFFSQEETRFARLW 252

  Fly   321 IALWSGLCFCSTLMTLTTFIIDTERFKYPERPIVFLSACYFMVAVGYLSRNFLQNEEIAC----- 380
            |..||.||..||..|:||:::|.:||:||||||:|||.||.||:|.|:: .|:..|.:.|     
  Rat   253 ILTWSVLCCASTFFTVTTYLVDMQRFRYPERPIIFLSGCYTMVSVAYIA-GFVLQERVVCNERFS 316

  Fly   381 -DGLLLRESSTGPHSCTLVFLLTYFFGMASSIWWVILSFTWFLAAGLKWGNEAITKHSQYFHLAA 444
             ||.......|....||::|::.|||.|||||||||||.|||||||:|||:|||..:||||||||
  Rat   317 EDGYRTVVQGTKKEGCTILFMMLYFFSMASSIWWVILSLTWFLAAGMKWGHEAIEANSQYFHLAA 381

  Fly   445 WLIPTVQSVAVLLLSAVDGDPILGICYVGNLNPDHLKTFVLAPLFVYLVIGTTFLMAGFVSLFRI 509
            |.:|.|:::.:|.:..:|||.:.|:|:||..:.|.|:.||||||||||.|||:||:|||||||||
  Rat   382 WAVPAVKTITILAMGQIDGDLLSGVCFVGLNSLDPLRGFVLAPLFVYLFIGTSFLLAGFVSLFRI 446

  Fly   510 RSVIKQQGGVGAGVKADKLEKLMIRIGIFSVLYTVPATIVIGCYLYEAAYFEDW--------IKA 566
            |:::|..     |.|.:|||:||:|||:|||||||||||||.||.||.|:.|.|        .|:
  Rat   447 RTIMKHD-----GTKTEKLERLMVRIGVFSVLYTVPATIVIACYFYEQAFREHWERSWVSQHCKS 506

  Fly   567 LACPCAQVKGPGKKPLYSVLMLKYFMALAVGITSGVWIWSGKTLESWRRFWRRL 620
            ||.||.....|...|.::|.|:||.|.|.||||||.||||||||.|||:|:.||
  Rat   507 LAIPCPAHYTPRMSPDFTVYMIKYLMTLIVGITSGFWIWSGKTLHSWRKFYTRL 560

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fz2NP_001262037.1 CRD_FZ5_like 63..182 CDD:143565 64/120 (53%)
Frizzled 308..618 CDD:279827 180/323 (56%)
Fzd2NP_742032.2 CRD_FZ2 40..166 CDD:143573 68/150 (45%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 166..194 10/34 (29%)
7tmF_FZD2 239..568 CDD:320373 182/328 (55%)
TM helix 1 249..273 CDD:320373 13/23 (57%)
TM helix 2 282..303 CDD:320373 13/21 (62%)
TM helix 3 333..355 CDD:320373 15/21 (71%)
TM helix 4 376..392 CDD:320373 9/15 (60%)
TM helix 5 414..437 CDD:320373 16/22 (73%)
TM helix 6 468..490 CDD:320373 18/21 (86%)
TM helix 7 519..544 CDD:320373 13/24 (54%)
Lys-Thr-X-X-X-Trp motif, mediates interaction with the PDZ domain of Dvl family members. /evidence=ECO:0000250 548..553 3/4 (75%)
PDZ-binding 568..570
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3577
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X126
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.