DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fz2 and SFRP4

DIOPT Version :9

Sequence 1:NP_001262037.1 Gene:fz2 / 40090 FlyBaseID:FBgn0016797 Length:806 Species:Drosophila melanogaster
Sequence 2:NP_003005.2 Gene:SFRP4 / 6424 HGNCID:10778 Length:346 Species:Homo sapiens


Alignment Length:142 Identity:57/142 - (40%)
Similarity:82/142 - (57%) Gaps:24/142 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 CEEITIPMCRGIGYNMTSFPNEMNHETQDEAGLEVHQFWPLVEIKCSPDLKFFLCSMYTPIC-LE 127
            ||.:.|||||.:.:|:|..||.::|.||:.|.|.:.|:..||::.||..|:||||:||.||| ||
Human    24 CEAVRIPMCRHMPWNITRMPNHLHHSTQENAILAIEQYEELVDVNCSAVLRFFLCAMYAPICTLE 88

  Fly   128 DYHKPLPVCRSVCERARSGCAPIMQQYSFEWPERMACEHLPLHG--------------------- 171
            ..|.|:..|:|||:|||..|.|:|:.|:..|||.:||:.||::.                     
Human    89 FLHDPIKPCKSVCQRARDDCEPLMKMYNHSWPESLACDELPVYDRGVCISPEAIVTDLPEDVKWI 153

  Fly   172 --DPDNLCMEQP 181
              .||.:..|:|
Human   154 DITPDMMVQERP 165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fz2NP_001262037.1 CRD_FZ5_like 63..182 CDD:143565 57/142 (40%)
Frizzled 308..618 CDD:279827
SFRP4NP_003005.2 CRD_FZ 20..146 CDD:321937 53/121 (44%)
NTR_like 188..296 CDD:321963
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 292..346
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165141197
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3577
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11309
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.