DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fz2 and frzb2

DIOPT Version :9

Sequence 1:NP_001262037.1 Gene:fz2 / 40090 FlyBaseID:FBgn0016797 Length:806 Species:Drosophila melanogaster
Sequence 2:NP_001016688.2 Gene:frzb2 / 549442 XenbaseID:XB-GENE-876718 Length:300 Species:Xenopus tropicalis


Alignment Length:129 Identity:50/129 - (38%)
Similarity:70/129 - (54%) Gaps:11/129 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 RCEEI--TIPMCRGIGYNMTSFPNEMNHETQDEAGLEVHQFWPLVEIKCSPDLKFFLCSMYTPIC 125
            ||..|  ::.:|..|||:....||.:.|:|..|...:...:.||:..:|.||.:.||||::.|||
 Frog    42 RCTRIPRSMALCYDIGYSEMRIPNLLEHDTMAEVIQQSSSWLPLLARECHPDARIFLCSLFAPIC 106

  Fly   126 LEDYHKPLPVCRSVCERARSGCAPIMQQYSFEWPERMACEHLPL-HGDPDNLCMEQPSYTEAGS 188
            |:.|..|   |||:||..|..|||||..|.:.|||.:.|:..|. ||    :|: .|.....||
 Frog   107 LDRYIYP---CRSLCEAVRGSCAPIMACYGYPWPEILRCDKFPEDHG----MCI-SPITNGTGS 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fz2NP_001262037.1 CRD_FZ5_like 63..182 CDD:143565 47/121 (39%)
Frizzled 308..618 CDD:279827
frzb2NP_001016688.2 CRD_crescent 41..175 CDD:143562 50/129 (39%)
NTR_Sfrp1_like 169..298 CDD:239635
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.