DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fz2 and sfrp1a

DIOPT Version :9

Sequence 1:NP_001262037.1 Gene:fz2 / 40090 FlyBaseID:FBgn0016797 Length:806 Species:Drosophila melanogaster
Sequence 2:NP_991148.1 Gene:sfrp1a / 402843 ZFINID:ZDB-GENE-040310-5 Length:296 Species:Danio rerio


Alignment Length:137 Identity:46/137 - (33%)
Similarity:74/137 - (54%) Gaps:12/137 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 YGVP-VIPKDPNLRCEEITIP--MCRGIGYNMTSFPNEMNHETQDEAGLEVHQFWPLVEIKCSPD 112
            ||.| ...|.|  :|.:|.:.  :|:|:||:....||.:.||:..|...:...:.||:...|.|.
Zfish    28 YGWPDNYDKPP--QCVDIPVDLRLCQGVGYHQMLLPNLLEHESMAEVKQQAGSWVPLLHKNCDPG 90

  Fly   113 LKFFLCSMYTPICLEDYHKPLPVCRSVCERARSGCAPIMQQYSFEWPERMACEHLPLHGDPDNLC 177
            .:..|||::.|:|:|   :|:..||.:||..|.||:|||..:.|.||..:.|:..|    .|::|
Zfish    91 TQLLLCSLFAPVCME---RPIYPCRRLCENVRDGCSPIMAAFGFPWPHILTCDKFP----QDDMC 148

  Fly   178 MEQPSYT 184
            :..|:.|
Zfish   149 INTPNDT 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fz2NP_001262037.1 CRD_FZ5_like 63..182 CDD:143565 39/120 (33%)
Frizzled 308..618 CDD:279827
sfrp1aNP_991148.1 CRD_FZ 34..155 CDD:295308 42/129 (33%)
NTR_Sfrp1_like 164..288 CDD:239635
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3577
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.