DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fz2 and Frzb

DIOPT Version :9

Sequence 1:NP_001262037.1 Gene:fz2 / 40090 FlyBaseID:FBgn0016797 Length:806 Species:Drosophila melanogaster
Sequence 2:NP_001093997.1 Gene:Frzb / 295691 RGDID:1311315 Length:323 Species:Rattus norvegicus


Alignment Length:211 Identity:76/211 - (36%)
Similarity:104/211 - (49%) Gaps:37/211 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 GMGGMGMGGHGLDASPAPGYGVPVIPKDPNLRCEEITIPMCRGIGYNMTSFPNEMNHETQDEAGL 96
            |.|.|.:|..||....|  ..:..:|......||.:.||:|:.:.:|||..||.::|.||..|.|
  Rat     5 GPGRMLLGWAGLLVLAA--LCLLQVPGAQAAACEPVRIPLCKSLPWNMTKMPNHLHHSTQANAIL 67

  Fly    97 EVHQFWPLVEIKCSPDLKFFLCSMYTPICLEDY-HKPLPVCRSVCERARSGCAPIMQQYSFEWPE 160
            .:.||..|:...|||||.||||:||.|||..|: |:|:..|:|||||||.||.||:.:|...|||
  Rat    68 AIEQFEGLLGTHCSPDLLFFLCAMYAPICTIDFQHEPIKPCKSVCERARQGCEPILIKYRHSWPE 132

  Fly   161 RMACEHLPLHGDPDNLCMEQPSYTEAGSGGSSGGSGGSGSGSGSGGKRKQGGSGSGGSGAGGSSG 225
            .:|||.||::  ...:|:...:...|                               .||.....
  Rat   133 SLACEELPVY--DRGVCISPEAIVTA-------------------------------DGADFPMD 164

  Fly   226 STSTKPCRGRNSKNCQ 241
            | ||..|||.:|:.|:
  Rat   165 S-STGHCRGTSSERCK 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fz2NP_001262037.1 CRD_FZ5_like 63..182 CDD:143565 57/119 (48%)
Frizzled 308..618 CDD:279827
FrzbNP_001093997.1 CRD_SFRP3 32..157 CDD:143550 58/157 (37%)
NTR_Sfrp3_like 188..297 CDD:239636
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166334865
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3577
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11309
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.