DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fz2 and Corin

DIOPT Version :9

Sequence 1:NP_001262037.1 Gene:fz2 / 40090 FlyBaseID:FBgn0016797 Length:806 Species:Drosophila melanogaster
Sequence 2:NP_872279.2 Gene:Corin / 289596 RGDID:727887 Length:1111 Species:Rattus norvegicus


Alignment Length:332 Identity:76/332 - (22%)
Similarity:115/332 - (34%) Gaps:115/332 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 SPAPG--------------YGVPVIPKDPNL----RCEEITIPMCRGIGYNMTSFPNEMNHETQD 92
            :|.||              .|..:...|.:|    .||.||:.:|..:.||:|.:||.:.|.||.
  Rat   485 TPCPGGDRGCLDSSCVESCAGSSLCDSDSSLSNCSHCEPITLELCMNLPYNLTHYPNYLGHRTQK 549

  Fly    93 EAGL--EVHQFWPLVEIKCSPDLKFFLCSMYTPICLEDYHKPLPVCRSVCERARSGCAPIMQQYS 155
            ||.:  |...|..||:..|...|.||.|::..|.|..:..:.:|.||.:||.::..|..::....
  Rat   550 EASISWESALFPALVQTNCYKYLMFFACTILVPKCDVNTGQRVPPCRLLCEHSKERCESVLGIVG 614

  Fly   156 FEWPERMACEHLPLHGDPDNLCM------EQ--PSYTEAGSGGSSGGSGGSGSGSGSGGKRKQGG 212
            .:|||...|...|.....:..|:      |:  ||:.:..||....||                 
  Rat   615 LQWPEDTDCSQFPEQSSDNQTCLLPNEDVEECSPSHFKCRSGRCVLGS----------------- 662

  Fly   213 SGSGGSGAGGSSGSTSTKPCRGRNSKNCQNPQGEKASGKECSCSCRSPLIFLGKEQLLQQQSQMP 277
                             :.|.|:  .:|.:...|:      :|.|        ||:.|       
  Rat   663 -----------------RRCDGQ--ADCDDDSDEE------NCGC--------KERDL------- 687

  Fly   278 MMHHPHHWYMNLTVQRIA------GVPNCGIP-----CKGPFFSNDEKDFAG-------LWIALW 324
                   |...|..|.:.      |.|:|...     |.  |..:||.:.|.       ||...|
  Rat   688 -------WECPLNKQCLKHTLICDGFPDCSDSMDEKNCS--FCQDDELECANHECVPRDLWCDGW 743

  Fly   325 SGLCFCS 331
            :.   ||
  Rat   744 TD---CS 747

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fz2NP_001262037.1 CRD_FZ5_like 63..182 CDD:143565 39/128 (30%)
Frizzled 308..618 CDD:279827 9/31 (29%)
CorinNP_872279.2 DDNN motif 93..96
CRD_corin_1 200..329 CDD:143554
LDLa 335..370 CDD:238060
LDLa 372..406 CDD:238060
Ldl_recept_a 413..443 CDD:395011
LDLa 453..480 CDD:238060
CRD_corin_2 521..641 CDD:143579 38/119 (32%)
Ldl_recept_a 646..680 CDD:395011 10/75 (13%)
LDLa <693..718 CDD:238060 4/24 (17%)
LDLa 721..755 CDD:238060 8/30 (27%)
SRCR_2 779..859 CDD:413346
Tryp_SPc 867..1098 CDD:238113
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3577
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.