DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fz2 and FRZB

DIOPT Version :9

Sequence 1:NP_001262037.1 Gene:fz2 / 40090 FlyBaseID:FBgn0016797 Length:806 Species:Drosophila melanogaster
Sequence 2:NP_001454.2 Gene:FRZB / 2487 HGNCID:3959 Length:325 Species:Homo sapiens


Alignment Length:289 Identity:86/289 - (29%)
Similarity:122/289 - (42%) Gaps:66/289 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 CEEITIPMCRGIGYNMTSFPNEMNHETQDEAGLEVHQFWPLVEIKCSPDLKFFLCSMYTPICLED 128
            ||.:.||:|:.:.:|||..||.::|.||..|.|.:.||..|:...|||||.||||:||.|||..|
Human    35 CEPVRIPLCKSLPWNMTKMPNHLHHSTQANAILAIEQFEGLLGTHCSPDLLFFLCAMYAPICTID 99

  Fly   129 Y-HKPLPVCRSVCERARSGCAPIMQQYSFEWPERMACEHLPLHGDPDNLCMEQPSYTEAGSGGSS 192
            : |:|:..|:|||||||.||.||:.:|...|||.:|||.||::  ...:|:...:...|......
Human   100 FQHEPIKPCKSVCERARQGCEPILIKYRHSWPENLACEELPVY--DRGVCISPEAIVTADGADFP 162

  Fly   193 GGSGGSGSGSGSGGKRKQGGSGSGGSGAGGSSGSTSTKPCRGRNSKNCQNPQGE--KASGKECSC 255
            ..|                   |.|:..|.||.....||.|.......:|....  :|..||...
Human   163 MDS-------------------SNGNCRGASSERCKCKPIRATQKTYFRNNYNYVIRAKVKEIKT 208

  Fly   256 SCRSPLIFLGKEQLLQQQSQMPMMHHPHHWYMNLTVQRIAGVPNCGIPCKGPFFSNDEKDFAGLW 320
            .|......:..:::|:..                    :..:|               :|...|:
Human   209 KCHDVTAVVEVKEILKSS--------------------LVNIP---------------RDTVNLY 238

  Fly   321 IALWSGLCFCSTLMTLTTFII----DTER 345
            .:  || |.|..|.....:||    |.||
Human   239 TS--SG-CLCPPLNVNEEYIIMGYEDEER 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fz2NP_001262037.1 CRD_FZ5_like 63..182 CDD:143565 57/118 (48%)
Frizzled 308..618 CDD:279827 12/42 (29%)
FRZBNP_001454.2 CRD_SFRP3 32..157 CDD:143550 57/123 (46%)
NTR_Sfrp3_like 188..297 CDD:239636 19/115 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 297..325
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165141199
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3577
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11309
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.