DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fz2 and sfrp-1

DIOPT Version :9

Sequence 1:NP_001262037.1 Gene:fz2 / 40090 FlyBaseID:FBgn0016797 Length:806 Species:Drosophila melanogaster
Sequence 2:NP_500977.2 Gene:sfrp-1 / 177401 WormBaseID:WBGene00022242 Length:314 Species:Caenorhabditis elegans


Alignment Length:272 Identity:67/272 - (24%)
Similarity:102/272 - (37%) Gaps:98/272 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 PVIPKDPNLRCEEI--TIPMCRGIGYNMTSFPNEMNHETQDEAGLEVHQFW-PLVEIKCSPDLKF 115
            ||.||     |.:|  .:.:|.||.|.....||.:.|||..|| :...:.| .|:.:.|.||.:.
 Worm    32 PVGPK-----CVDIPSNLSICNGIEYTQMRLPNILEHETVSEA-IHASKDWESLLRLNCHPDTQR 90

  Fly   116 FLCSMYTPICLEDYHKPLPVCRSVCERARSGCAPIMQQYSFEWPERMACEHLPLHGDPDNLCME- 179
            ||||::.|:||....:.:..|:|:|...:.||...|..|.|.|||.::||..    :.|::|:: 
 Worm    91 FLCSLFAPVCLMQMDRLILPCKSLCMAVKQGCENRMANYGFPWPEMLSCEKF----EDDDMCIKP 151

  Fly   180 -QPSYTEAGSGGSSGGSGGSGSGSGSGGKRKQGGSGSGGSGAGGSSGSTSTKPC----------- 232
             ||:...|||                                     ||:...|           
 Worm   152 MQPAKPPAGS-------------------------------------STTCTACSQVATYENLVD 179

  Fly   233 ---------------------RGRNSKNCQNPQGEKASG-----------KECSCSCRSPLIFLG 265
                                 |.||.::.:  :||:..|           .:.||.|..| :...
 Worm   180 QFCRSHLVLKAKVIRDSPTHIRVRNGRSLK--KGERRRGVSDVEIRLSSESDGSCPCNIP-VKNQ 241

  Fly   266 KEQLLQQQSQMP 277
            .|:||...|:.|
 Worm   242 NEKLLVMASRQP 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fz2NP_001262037.1 CRD_FZ5_like 63..182 CDD:143565 41/123 (33%)
Frizzled 308..618 CDD:279827
sfrp-1NP_500977.2 CRD_FZ 37..161 CDD:382974 43/128 (34%)
NTR_Sfrp1_like 162..283 CDD:239635 18/95 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3577
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.