Sequence 1: | NP_001262037.1 | Gene: | fz2 / 40090 | FlyBaseID: | FBgn0016797 | Length: | 806 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_500977.2 | Gene: | sfrp-1 / 177401 | WormBaseID: | WBGene00022242 | Length: | 314 | Species: | Caenorhabditis elegans |
Alignment Length: | 272 | Identity: | 67/272 - (24%) |
---|---|---|---|
Similarity: | 102/272 - (37%) | Gaps: | 98/272 - (36%) |
- Green bases have known domain annotations that are detailed below.
Fly 54 PVIPKDPNLRCEEI--TIPMCRGIGYNMTSFPNEMNHETQDEAGLEVHQFW-PLVEIKCSPDLKF 115
Fly 116 FLCSMYTPICLEDYHKPLPVCRSVCERARSGCAPIMQQYSFEWPERMACEHLPLHGDPDNLCME- 179
Fly 180 -QPSYTEAGSGGSSGGSGGSGSGSGSGGKRKQGGSGSGGSGAGGSSGSTSTKPC----------- 232
Fly 233 ---------------------RGRNSKNCQNPQGEKASG-----------KECSCSCRSPLIFLG 265
Fly 266 KEQLLQQQSQMP 277 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
fz2 | NP_001262037.1 | CRD_FZ5_like | 63..182 | CDD:143565 | 41/123 (33%) |
Frizzled | 308..618 | CDD:279827 | |||
sfrp-1 | NP_500977.2 | CRD_FZ | 37..161 | CDD:382974 | 43/128 (34%) |
NTR_Sfrp1_like | 162..283 | CDD:239635 | 18/95 (19%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3577 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |