DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LMX1A and Antp

DIOPT Version :9

Sequence 1:NP_001167540.1 Gene:LMX1A / 4009 HGNCID:6653 Length:382 Species:Homo sapiens
Sequence 2:NP_996167.1 Gene:Antp / 40835 FlyBaseID:FBgn0260642 Length:378 Species:Drosophila melanogaster


Alignment Length:134 Identity:32/134 - (23%)
Similarity:46/134 - (34%) Gaps:48/134 - (35%)


- Green bases have known domain annotations that are detailed below.


Human   189 GKDHKRPKRPRTILTTQQRRAFKASFEVSSKPCRKVRETLAAETGLSVRVVQVWFQNQRAKMKKL 253
            ||..:| ||.|...|..|....:..|..:....|:.|..:|....|:.|.:::||||:|.|.|| 
  Fly   292 GKCQER-KRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKK- 354

Human   254 ARRQQQQQQDQQNTQRLSSAQTNGGGSAGMEGIMNPYTALPTPQQLLAIEQSVYSSDPFRQGLTP 318
                       :|       :|.|...:|.||                            ..:||
  Fly   355 -----------EN-------KTKGEPGSGGEG----------------------------DEITP 373

Human   319 PQMP 322
            |..|
  Fly   374 PNSP 377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LMX1ANP_001167540.1 LIM1_Lmx1a 35..86 CDD:188756
LIM2_Lmx1a_Lmx1b 94..148 CDD:188764
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 161..208 8/18 (44%)
Homeobox 198..252 CDD:395001 15/53 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 252..285 5/32 (16%)
AntpNP_996167.1 KLF1_2_4_N <161..306 CDD:425360 6/14 (43%)
Homeobox 301..354 CDD:395001 15/52 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3844
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.