powered by:
Protein Alignment Gem2 and YLR053C
DIOPT Version :9
Sequence 1: | NP_001262034.1 |
Gene: | Gem2 / 40087 |
FlyBaseID: | FBgn0036850 |
Length: | 245 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_013154.1 |
Gene: | YLR053C / 850742 |
SGDID: | S000004043 |
Length: | 108 |
Species: | Saccharomyces cerevisiae |
Alignment Length: | 33 |
Identity: | 7/33 - (21%) |
Similarity: | 16/33 - (48%) |
Gaps: | 0/33 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 210 LRNQLKEDEVQRAAPYNLLLTLTVQVFAQNDFK 242
:.:|...|.::....:|:.||..|:...|..::
Yeast 45 MESQDNNDSIEDFLFFNINLTQEVEFENQRQYE 77
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
Gem2 | NP_001262034.1 |
SIP1 |
18..239 |
CDD:282754 |
6/28 (21%) |
YLR053C | NP_013154.1 |
None |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
1 |
0.950 |
- |
0 |
Normalized mean entropy |
S3221 |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.950 |
|
Return to query results.
Submit another query.