DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gem2 and AT1G54385

DIOPT Version :10

Sequence 1:NP_649092.1 Gene:Gem2 / 40087 FlyBaseID:FBgn0036850 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_683432.1 Gene:AT1G54385 / 841880 AraportID:AT1G54385 Length:560 Species:Arabidopsis thaliana


Alignment Length:98 Identity:24/98 - (24%)
Similarity:44/98 - (44%) Gaps:14/98 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 DSSFDPQKPPESGEE---YLMHMFYERKRCPAVVTKRSSKIRN---NTGNTTLEMLDNPELPPFK 79
            ||...|....|:|:|   :||...  |...|:...:||.:|..   |..:|..:::.:.:.|...
plant   397 DSPLVPYDTCENGDEFEGFLMESL--RNTTPSPQRQRSRRINAEDFNIFSTPRKLISSLQYPDDV 459

  Fly    80 CL----LPTPEWRDEQVKSFQAARSQVLVLRKE 108
            .|    :.:|..|.|:.|:..:.::.  .|||:
plant   460 DLDHSDIQSPILRGEREKTIGSRKNP--KLRKQ 490

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gem2NP_649092.1 SIP1 21..238 CDD:461493 24/98 (24%)
AT1G54385NP_683432.1 None

Return to query results.
Submit another query.