DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gem2 and AT1G54380

DIOPT Version :9

Sequence 1:NP_001262034.1 Gene:Gem2 / 40087 FlyBaseID:FBgn0036850 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_564657.1 Gene:AT1G54380 / 841879 AraportID:AT1G54380 Length:515 Species:Arabidopsis thaliana


Alignment Length:287 Identity:74/287 - (25%)
Similarity:107/287 - (37%) Gaps:97/287 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 EPEDQT-------------FQLQALEICEPDSSFDPQKPPESGEEYLMHMFYERKRCPAVVTKRS 55
            :|||.|             |::..    |||.|   ..|||.|.|||..:.:|.|..|.|   |.
plant   271 DPEDYTDDNDDYNSILRPAFEVDG----EPDFS---TGPPEDGLEYLRRVRWEAKGIPNV---RV 325

  Fly    56 SKIRNNT---GNTTLEMLDNPELPPFKC---LLPTPEWRDEQVKSFQAARSQVLVLRKELANNNY 114
            :||..:|   ...::.|...||:|  ||   |||..||.|..:..|       :.||:.|..:  
plant   326 AKIDESTYIKKEQSVYMPLIPEIP--KCPEYLLPMKEWEDSLLLDF-------VHLRQTLTQS-- 379

  Fly   115 DQSGEPPLTSDQEKWKEFCRNQQPLLSTLLHLTQNDLELLLEMLSKWL----------------- 162
            ..|.|..:.|.|      |..                :||:||.:|.|                 
plant   380 ANSCEDEIISSQ------CVE----------------DLLVEMFNKHLHTEEDESFGEVVTDIQG 422

  Fly   163 QDPNTTVDLLHD-VWL-----------ARWLYATLVCLHLPLEPHVFSTLRYIARTCIHLRN--- 212
            .|..|.|..|.. :.|           .:|:.|....|..||:....:.||.:.|.|..:|.   
plant   423 MDSVTRVSKLKKRICLVEKESGLQSSDCKWVVALCASLETPLDADTCACLRGLLRKCASVRAETS 487

  Fly   213 -QLKEDEVQRAAPYNLLLTLTVQVFAQ 238
             ::.::||...|  |:|:|:..:.|.|
plant   488 LEVGDEEVITMA--NMLITIAGRYFGQ 512

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gem2NP_001262034.1 SIP1 18..239 CDD:282754 69/260 (27%)
AT1G54380NP_564657.1 SIP1 291..513 CDD:282754 69/267 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 42 1.000 Domainoid score I4802
eggNOG 1 0.900 - - E1_28H7D
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1235594at2759
OrthoFinder 1 1.000 - - FOG0005780
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_104791
Panther 1 1.100 - - LDO PTHR12794
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.780

Return to query results.
Submit another query.