DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gem2 and Gemin2

DIOPT Version :9

Sequence 1:NP_001262034.1 Gene:Gem2 / 40087 FlyBaseID:FBgn0036850 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_079932.2 Gene:Gemin2 / 66603 MGIID:1913853 Length:269 Species:Mus musculus


Alignment Length:261 Identity:75/261 - (28%)
Similarity:112/261 - (42%) Gaps:38/261 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 QLQALEICEPDSSFDPQKPPESGEEYLMHMFYERKRCPAVVTKR--SSKI-RNNTGNTTLEMLDN 72
            :|..:|.|:....|||..||.:.:|||..:..|..:||.||..:  ..|: |..:.|.:|.... 
Mouse    16 RLLPVEPCDLTEGFDPSVPPRTPQEYLRRVQIEAAQCPDVVVAQIDPKKLKRKQSVNISLSGCQ- 79

  Fly    73 PELPPFKCLLPTPEWRDEQVKSFQAARSQVLVLRKELANNNYDQSGEPPLTSDQEKWKEFCRNQQ 137
               |..:...||.:|:.:||..|...|..|...|....:...|.:...|.:.|:|.||:||..::
Mouse    80 ---PAPEGYSPTLQWQQQQVAHFSTVRQSVHKHRNHWKSQQLDSNVAMPKSEDEEGWKKFCLGER 141

  Fly   138 -------------------------PLLSTLLHLTQNDLELLLEMLSKWLQDPNTTVDLLHDVWL 177
                                     ||||.:..:.|..:..:||.||.|..:.:.|.:      |
Mouse   142 LCAEGATGPSTEESPGIDYVQVGFPPLLSIVSRMNQTTITSVLEYLSNWFGERDFTPE------L 200

  Fly   178 ARWLYATLVCLHLPLEPHVFSTLRYIARTCIHLRNQLKEDEVQRAAPYNLLLTLTVQVFAQNDFK 242
            .||.||.|.||..||.|...|.:|.:||.|..:|..:...:.:|....|||:.|..:.|.|.|..
Mouse   201 GRWFYALLACLEKPLLPEAHSLIRQLARRCSEVRLLVGSKDDERVPALNLLICLVSRYFDQRDLA 265

  Fly   243 D 243
            |
Mouse   266 D 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gem2NP_001262034.1 SIP1 18..239 CDD:282754 70/248 (28%)
Gemin2NP_079932.2 SIP1 22..261 CDD:282754 70/248 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167850814
Domainoid 1 1.000 100 1.000 Domainoid score I7022
eggNOG 1 0.900 - - E1_28H7D
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H37827
Inparanoid 1 1.050 109 1.000 Inparanoid score I4888
Isobase 1 0.950 - 0 Normalized mean entropy S3221
OMA 1 1.010 - - QHG55374
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005780
OrthoInspector 1 1.000 - - oto93141
orthoMCL 1 0.900 - - OOG6_104791
Panther 1 1.100 - - LDO PTHR12794
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4058
SonicParanoid 1 1.000 - - X6261
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1615.740

Return to query results.
Submit another query.