powered by:
Protein Alignment Gem2 and SMAD4
DIOPT Version :9
Sequence 1: | NP_001262034.1 |
Gene: | Gem2 / 40087 |
FlyBaseID: | FBgn0036850 |
Length: | 245 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_005350.1 |
Gene: | SMAD4 / 4089 |
HGNCID: | 6770 |
Length: | 552 |
Species: | Homo sapiens |
Alignment Length: | 35 |
Identity: | 9/35 - (25%) |
Similarity: | 11/35 - (31%) |
Gaps: | 10/35 - (28%) |
- Green bases have known domain annotations that are detailed below.
Fly 5 PEDQTFQLQALEICEPDSSFDPQKPPESGEEYLMH 39
|..|...|| ..|..||..|..:.:|
Human 281 PHHQNGHLQ----------HHPPMPPHPGHYWPVH 305
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
1 |
0.950 |
- |
0 |
Normalized mean entropy |
S3221 |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.950 |
|
Return to query results.
Submit another query.