Protein Alignment Gem2 and SMAD4

DIOPT Version :9

• Sequence 1: NP_001262034.1
• Gene: Gem2 / 40087
• FlyBaseID: FBgn0036850
• Length: 245
• Species: Drosophila melanogaster
• Sequence 2: NP_005350.1
• Gene: SMAD4 / 4089
• HGNCID: 6770
• Length: 552
• Species: Homo sapiens
• Alignment Length: 35
• Identity: 9/35 - (25%)
• Similarity: 11/35 - (31%)
• Gaps: 10/35 - (28%)

  Fly     5 PEDQTFQLQALEICEPDSSFDPQKPPESGEEYLMH 39
            |..|...||          ..|..||..|..:.:|
Human   281 PHHQNGHLQ----------HHPPMPPHPGHYWPVH 305

Known Domains

Gene	Sequence	Domain	Region	External ID	Identity
Gem2	NP_001262034.1	SIP1	18..239	CDD:282754	5/22 (23%)
SMAD4	NP_005350.1	Mediates interaction with ZBTB7A. /evidence=ECO:0000269|PubMed:25514493	1..322		9/35 (26%)
		MH1_SMAD_4	14..138	CDD:199816
		Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite	168..194
		Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite	236..256
		SAD	275..320		9/35 (26%)
		MH2_SMAD_4	320..541	CDD:199823

Information from Original Tools

Tool	Simple Score	Weighted Score	Original Tool Information
			BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	1	0.950	-	0	Normalized mean entropy	S3221
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.950