powered by:
Protein Alignment Gem2 and zen
DIOPT Version :9
Sequence 1: | NP_001262034.1 |
Gene: | Gem2 / 40087 |
FlyBaseID: | FBgn0036850 |
Length: | 245 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_476793.1 |
Gene: | zen / 40828 |
FlyBaseID: | FBgn0004053 |
Length: | 353 |
Species: | Drosophila melanogaster |
Alignment Length: | 38 |
Identity: | 10/38 - (26%) |
Similarity: | 17/38 - (44%) |
Gaps: | 5/38 - (13%) |
- Green bases have known domain annotations that are detailed below.
Fly 82 LPTPEWRDEQVKSFQAARS-----QVLVLRKELANNNY 114
||:....|.|....:.:|: |::.|..|..:|.|
Fly 77 LPSQPNHDSQRVKLKRSRTAFTSVQLVELENEFKSNMY 114
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
1 |
0.950 |
- |
0 |
Normalized mean entropy |
S3221 |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.950 |
|
Return to query results.
Submit another query.