DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gem2 and yip12

DIOPT Version :9

Sequence 1:NP_001262034.1 Gene:Gem2 / 40087 FlyBaseID:FBgn0036850 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_001018218.1 Gene:yip12 / 3361408 PomBaseID:SPAPB17E12.02 Length:235 Species:Schizosaccharomyces pombe


Alignment Length:209 Identity:46/209 - (22%)
Similarity:86/209 - (41%) Gaps:34/209 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 EDQTFQLQALEICEPDSSFDPQK--PPESGEEYLMHMFYE-RKRCPAVVTKRSSKIRNNTGNTTL 67
            :::|.|..|....:.:|:.:..:  .|..|.:||..:..| ||..|.|..:|..:.|.......|
pombe    19 DEETNQRSAFPQIDNNSASESLEYDIPLDGLDYLATVREEARKLVPFVAARREPETRETIPLRKL 83

  Fly    68 EM-LDNPELPPF-KCLLPTPEWRDEQVKSFQAARS-QVLVLRKELANNNYDQSGEPPLTSDQEKW 129
            |: .......|| :.||...:...|:::.:..:.| ...:|.|.|                 ::|
pombe    84 EIEAGKKSFDPFLRYLLNIIDKEGERLEQYMESSSLDASILPKNL-----------------QQW 131

  Fly   130 KEFCRNQQPLLSTLLHLTQNDLELLLEMLSKWLQDPNTTVDLLHDVWLARWLYATLVCLHLP--L 192
            :.:..::.|..:.|..:....:..:||.||.||:  ...:||     .::|::.  .|..||  |
pombe   132 RVYIEHKAPCWAILAVVDLATVLEILESLSSWLE--KDAIDL-----QSQWIFC--FCYKLPELL 187

  Fly   193 EPHVFSTLRYIART 206
            .....||||.:.::
pombe   188 NGEDISTLRSVLKS 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gem2NP_001262034.1 SIP1 18..239 CDD:282754 43/197 (22%)
yip12NP_001018218.1 SIP1 45..208 CDD:282754 42/183 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR12794
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.