DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gem2 and smi-1

DIOPT Version :9

Sequence 1:NP_001262034.1 Gene:Gem2 / 40087 FlyBaseID:FBgn0036850 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_001022847.1 Gene:smi-1 / 189726 WormBaseID:WBGene00004886 Length:254 Species:Caenorhabditis elegans


Alignment Length:270 Identity:62/270 - (22%)
Similarity:104/270 - (38%) Gaps:62/270 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 EIC-EPDSSF-----DPQKPPESGEEYLMHMFYERKRCPAVV-------------TKRSSKIRNN 61
            |.| .|...|     |...|..|..:||..|..||:....||             .|:..:...:
 Worm     4 EACLGPSDDFEADDVDMTSPAMSAAQYLRQMQAERRGTKNVVRIAQKSPDSTSPEAKKQKQWLES 68

  Fly    62 TGNTTLEMLDNPELPPFKCLLPTPEWRDEQVKSFQAARSQVLVLRKELANNNYDQSGEPPLTSDQ 126
            .|...::.::.|.  |   |:|:.|||.|:.:.|:..|:::.:..::.:....|:...|    ::
 Worm    69 VGYQEVKKIETPS--P---LIPSEEWRQEKCRKFEETRAKMALKIEKFSPMRIDRLNSP----EE 124

  Fly   127 EKWKEFCRNQ------------------QPLLSTLLHLTQNDLELLLEMLSKW-----LQDPNTT 168
            |:|.|....:                  .|.|..:..:.:..|..|:|.|..|     |..|   
 Worm   125 EEWHEILLEKCLPEFQDIAGNFLNHTGTPPALRMVFSIPKRHLSQLIEYLVDWSIEEGLNRP--- 186

  Fly   169 VDLLHDVWLARWLYATLVCLHLPLEPHVFSTLRYIARTCIHLRNQLKEDEVQRAAPYNLLLTLTV 233
                    :..|:|:.|..:.|||...|.|.||.:.:.|..||::|..|....|..::|.:|:..
 Worm   187 --------IREWIYSLLAVIDLPLVQDVVSALRRLVKECRSLRSELSIDRKSEANEFSLFITIIT 243

  Fly   234 QVFAQNDFKD 243
            ..|.|.|..|
 Worm   244 IFFGQKDLAD 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gem2NP_001262034.1 SIP1 18..239 CDD:282754 58/262 (22%)
smi-1NP_001022847.1 SIP1 14..249 CDD:282754 55/254 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160167901
Domainoid 1 1.000 65 1.000 Domainoid score I6662
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 69 1.000 Inparanoid score I3925
Isobase 1 0.950 - 0 Normalized mean entropy S3221
OMA 1 1.010 - - QHG55374
OrthoDB 1 1.010 - - D1235594at2759
OrthoFinder 1 1.000 - - FOG0005780
OrthoInspector 1 1.000 - - oto20165
orthoMCL 1 0.900 - - OOG6_104791
Panther 1 1.100 - - LDO PTHR12794
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4058
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1312.890

Return to query results.
Submit another query.