DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gem2 and gemin2

DIOPT Version :9

Sequence 1:NP_001262034.1 Gene:Gem2 / 40087 FlyBaseID:FBgn0036850 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_001096228.1 Gene:gemin2 / 100124782 XenbaseID:XB-GENE-941786 Length:267 Species:Xenopus tropicalis


Alignment Length:269 Identity:77/269 - (28%)
Similarity:115/269 - (42%) Gaps:33/269 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MQHEPEDQTFQLQALEICEPDSSFDPQKPPESGEEYLMHMFYERKRCPAVVTKRSSKIRNNTGNT 65
            |...||:...:|..:..|:....|||..||.:.:|||..:..|..|||.||..:....:.....|
 Frog     1 MDSGPEELMPRLLPVGNCDLPEDFDPAVPPRTPQEYLRRVQIEAARCPDVVIAQIDPKKLRKKQT 65

  Fly    66 TLEMLDNPELPPFKCLLPTPEWRDEQVKSFQAARSQVLVLRKELANNNYDQSGEPPLTSDQEKWK 130
            ....|...:..| :...|:..|:.:||..|.|.|..:...|....:...|.:...|.|.|:|.||
 Frog    66 VSISLSGCQPAP-EGYSPSLRWQQQQVAQFSAVRQSLHKHRSHWRSQPLDSNVTMPSTEDEESWK 129

  Fly   131 EFCRNQQ--------------------------PLLSTLLHLTQNDLELLLEMLSKWLQDPNTTV 169
            :||..::                          ||||.:..::|..:..:||.|..|.::.|.|.
 Frog   130 KFCLGERLYSDLAAALNSDSQHPGIDYIKVGFPPLLSIVSRMSQATVTSVLEYLVNWFEERNFTP 194

  Fly   170 DLLHDVWLARWLYATLVCLHLPLEPHVFSTLRYIARTCIHLRNQLKEDEVQRAAPYNLLLTLTVQ 234
            :      |.|||||.|.||..||.|...|.:|.:||.|..:|..::..|.:|.:..||.:.|..:
 Frog   195 E------LGRWLYALLACLEKPLLPEAHSLIRQLARRCSQVRAGVEHKEDERVSALNLFICLVGR 253

  Fly   235 VFAQNDFKD 243
            .|.|.|..|
 Frog   254 YFEQRDLAD 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gem2NP_001262034.1 SIP1 18..239 CDD:282754 70/246 (28%)
gemin2NP_001096228.1 SIP1 18..257 CDD:368203 70/245 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 106 1.000 Domainoid score I6543
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H37827
Inparanoid 1 1.050 116 1.000 Inparanoid score I4674
OMA 1 1.010 - - QHG55374
OrthoDB 1 1.010 - - D1235594at2759
OrthoFinder 1 1.000 - - FOG0005780
OrthoInspector 1 1.000 - - oto103395
Panther 1 1.100 - - LDO PTHR12794
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4058
SonicParanoid 1 1.000 - - X6261
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1212.110

Return to query results.
Submit another query.