DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14079 and spata6l

DIOPT Version :9

Sequence 1:NP_649091.1 Gene:CG14079 / 40086 FlyBaseID:FBgn0036849 Length:269 Species:Drosophila melanogaster
Sequence 2:NP_001072232.1 Gene:spata6l / 779679 XenbaseID:XB-GENE-984718 Length:397 Species:Xenopus tropicalis


Alignment Length:290 Identity:71/290 - (24%)
Similarity:118/290 - (40%) Gaps:78/290 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 VKLDLQLHALTCPGVWLCSHGYLEATIKTLGYYFRTGPMEPRFPMLCHDQFTMEGYFKSVGCLEE 72
            :.::||:||:|||||:|.....:...:..||.:..||.:...||:|.|::...|..|     |:.
 Frog     5 IVIELQIHAVTCPGVFLPEKDDILLNVSILGQHKETGCLPSVFPLLFHEKMRFEKVF-----LKA 64

  Fly    73 MHELLKAEQLE--------ITVWQNGRRLAYFVGSLSDVMQPTFPRLSCAHSS-NVQLLMKATPA 128
            :.....|:.||        |.:..:...||.|..:....:.|. |:|:.|:.. :.::|||....
 Frog    65 VDPAALAQSLENHITRFELIQLTHSADILAVFEENTRQFLFPE-PKLTPAYPGVDREVLMKTVNG 128

  Fly   129 FPGILAPKVELSAQLTTQDR----KKVCSC---------------------------SSSREYSA 162
            |||| |||:|.|.:.|.:::    :|.|..                           |.::.||:
 Frog   129 FPGI-APKIEFSTRTTIKEKPHDFQKKCPAVKSYISRPLTVSSRKSRSTSSNPVRGKSPAKNYSS 192

  Fly   163 P----------PVNRHVESRCLGHLDQPRKQQTV---CHGRQSNCCP---------SGSYAAWRA 205
            |          |.:|    ||:..|::..:||..   .:...::..|         |.|:     
 Frog   193 PTKSSKSRSPSPFSR----RCVNELNKNVQQQLANLSLNSSDNDTRPPFIVRHVDSSKSF----- 248

  Fly   206 GSPAQQKQQERRLSSCSSTTQLSSLSQSSS 235
            |....|..:.|..|..||.|..|.|.::.|
 Frog   249 GDSVLQHSKARHQSKLSSKTHQSRLKRALS 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14079NP_649091.1 SPATA6 10..144 CDD:291570 44/142 (31%)
spata6lNP_001072232.1 SPATA6 7..144 CDD:291570 44/143 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 58 1.000 Domainoid score I10616
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1154886at2759
OrthoFinder 1 1.000 - - FOG0003962
OrthoInspector 1 1.000 - - oto104445
Panther 1 1.100 - - LDO PTHR16435
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X7279
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.020

Return to query results.
Submit another query.