DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14079 and Spata6

DIOPT Version :9

Sequence 1:NP_649091.1 Gene:CG14079 / 40086 FlyBaseID:FBgn0036849 Length:269 Species:Drosophila melanogaster
Sequence 2:NP_080746.3 Gene:Spata6 / 67946 MGIID:1915196 Length:488 Species:Mus musculus


Alignment Length:240 Identity:60/240 - (25%)
Similarity:98/240 - (40%) Gaps:27/240 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 KRFYVKLDLQLHALTCPGVWLCSHGYLEATIKTLGYYFRTGPMEPRFPMLCHDQFTMEGYFKS-- 66
            |.....|.|::.::|||||.|.....:..:|...|.|.:|..:...||::.:.:...|..|..  
Mouse     5 KALQCALALEIRSVTCPGVVLKDKEDIYLSICVFGQYKKTQCVPATFPLVFNARMVFEKVFPEAV 69

  Fly    67 -----VGCLEEMHELLKAEQLEITVWQNGRRLAYFVGSLSDVMQPTFPRLSCAHSSNVQLLMKAT 126
                 |..||....:.:..||...|   |..|:.:..:..|.|.|...::|..|.||.|:.|:..
Mouse    70 DPGDVVAQLEYDTAVFELIQLVPPV---GETLSTYDENTRDFMFPGPNQMSGHHDSNRQVTMRRI 131

  Fly   127 PAFPGILAPKVELS-----AQLTTQDRKKVCSCSSSREYSAPPVNR-HVESRCLGHLDQPRKQQT 185
            ....|| |||:|.|     .:.....||  |.......|.:.||.: |...:|.....|.:|.::
Mouse   132 SGLRGI-APKLEFSTTSVITECLISSRK--CRTQDKFTYHSAPVEKSHGRLQCRTSRSQKKKSKS 193

  Fly   186 VCHGRQSNCCPSGSY----AAWRAGSPAQQKQQERRLSSCSSTTQ 226
              ..|...|..:.:|    .:.::.||:  ...:||:...|..|:
Mouse   194 --PERSKYCINTKNYEQPTISSKSHSPS--PYTKRRMCELSEDTR 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14079NP_649091.1 SPATA6 10..144 CDD:291570 40/145 (28%)
Spata6NP_080746.3 SPATA6 11..149 CDD:291570 40/141 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 176..225 9/52 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167834921
Domainoid 1 1.000 42 1.000 Domainoid score I12386
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003962
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_109564
Panther 1 1.100 - - O PTHR16435
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.800

Return to query results.
Submit another query.