DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14079 and spata6

DIOPT Version :9

Sequence 1:NP_649091.1 Gene:CG14079 / 40086 FlyBaseID:FBgn0036849 Length:269 Species:Drosophila melanogaster
Sequence 2:XP_005166898.1 Gene:spata6 / 550512 ZFINID:ZDB-GENE-050417-351 Length:456 Species:Danio rerio


Alignment Length:284 Identity:73/284 - (25%)
Similarity:121/284 - (42%) Gaps:44/284 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSHKRFYVKLDLQLHALTCPGVWLCSHGYLEATIKTLGYYFRTGPMEPRFPMLCHDQF----TME 61
            |..|.....::|::.|:|||||.|.|...:..:::.:|.|.::..:.|.||:|.|::.    |..
Zfish     1 MRQKANKCTVELKVQAITCPGVMLPSQEDIYLSVRIMGQYQKSKCVPPVFPLLLHEKMVFVKTFV 65

  Fly    62 GYFKSVGCLEEMHELLKAEQLEITVWQNGRRLAYFVGSLSDVMQPTFPRLS-CAHSSNVQLLMKA 125
            |........|.:.....:.:|...|...|..||.|.....:.:.|. |||: .:.....::|||.
Zfish    66 GMLDPAAVAEHLENDTTSLELIQLVPPEGEILATFEADTREFLYPG-PRLTPRSPGPEREILMKR 129

  Fly   126 TPAFPGILAPKVELSAQLTTQD---RKKVCSCSSSREYSAPPVNRHVESRCLGHLDQPRKQQTVC 187
            :.:|||| :|:||.|.....::   :....:.||....||.|.:...   ||....:.:|...| 
Zfish   130 SISFPGI-SPRVEFSTTSIIEECDVKHGQSAVSSHGRSSAKPSSMRT---CLSSAKKKKKSDKV- 189

  Fly   188 HGRQSNCCPSGSYAAWRAGSPAQQKQQERRLSSCSSTTQLSSL---------------------S 231
                |:|....|..|.|:.:|:....::....|..:..:||.|                     |
Zfish   190 ----SSCGYEKSTVASRSRAPSPYTHRKMCQLSEEARQRLSHLKLGPYTFQKETAPQAPFVVPRS 250

  Fly   232 QSSSLTQCS-HLSSCS----SPLD 250
            .::||.:.| ||:|.|    ||||
Zfish   251 PNTSLMESSTHLTSQSFTKRSPLD 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14079NP_649091.1 SPATA6 10..144 CDD:291570 40/138 (29%)
spata6XP_005166898.1 SPATA6 10..148 CDD:291570 40/139 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170577994
Domainoid 1 1.000 55 1.000 Domainoid score I11113
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 59 1.000 Inparanoid score I5408
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1154886at2759
OrthoFinder 1 1.000 - - FOG0003962
OrthoInspector 1 1.000 - - otm25441
orthoMCL 1 0.900 - - OOG6_109564
Panther 1 1.100 - - O PTHR16435
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5690
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1110.930

Return to query results.
Submit another query.