DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14079 and spata6l

DIOPT Version :9

Sequence 1:NP_649091.1 Gene:CG14079 / 40086 FlyBaseID:FBgn0036849 Length:269 Species:Drosophila melanogaster
Sequence 2:NP_956706.1 Gene:spata6l / 393384 ZFINID:ZDB-GENE-040426-1369 Length:338 Species:Danio rerio


Alignment Length:234 Identity:64/234 - (27%)
Similarity:101/234 - (43%) Gaps:30/234 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSHKRFYVKLDLQLHALTCPGVWLCSHGYLEATIKTLGYYFRTGPMEPRFPMLCHDQFTMEGYFK 65
            |.||...|.::|.|.|:|||||.|.:...:..::..:..|.:|..:...||:|..::...|....
Zfish     1 MPHKAVKVIVELHLRAITCPGVHLPAKDDVYLSVSLMNRYRKTECLPAVFPILIREKIRFEKILN 65

  Fly    66 SVGCLEEMHELLKAEQLEITVWQ----NGRRLAYFVGSLSDVMQPTFPRLSCAHSS-NVQLLMKA 125
            .....|.:.|.|:.|.::|.:.|    .|..||.|.......:.|. |:|..:.|. ..::||..
Zfish    66 YATDPEAIAEFLQYEAVKIELIQLIPPAGEILASFEEDARSFLFPE-PKLVPSFSGVEREVLMTR 129

  Fly   126 TPAFPGILAPKVELSAQLTTQD---------------RKKVCSCSSSREYSAPPVNRHVESR-CL 174
            .|.|||| :|::|.|.:.|..:               |:|  :...||:.|:....||:.|. | 
Zfish   130 HPTFPGI-SPRLEFSTKTTISEISSDNGFLTLPVRRMRRK--TSRKSRKQSSSSSLRHLSSAPC- 190

  Fly   175 GHLDQPRKQQTVCHGRQSNCCP-SGSYAAWRAGSPAQQK 212
               .|.|.:.|....|.|...| |.....:|:.||.:.|
Zfish   191 ---SQRRDRNTDQDQRSSGYSPVSARKPRFRSLSPHRSK 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14079NP_649091.1 SPATA6 10..144 CDD:291570 39/138 (28%)
spata6lNP_956706.1 SPATA6 10..148 CDD:291570 39/139 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170577995
Domainoid 1 1.000 55 1.000 Domainoid score I11113
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1154886at2759
OrthoFinder 1 1.000 - - FOG0003962
OrthoInspector 1 1.000 - - otm25441
orthoMCL 1 0.900 - - OOG6_109564
Panther 1 1.100 - - LDO PTHR16435
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5690
SonicParanoid 1 1.000 - - X7279
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1110.840

Return to query results.
Submit another query.