DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14079 and Spata6l

DIOPT Version :9

Sequence 1:NP_649091.1 Gene:CG14079 / 40086 FlyBaseID:FBgn0036849 Length:269 Species:Drosophila melanogaster
Sequence 2:XP_011245574.3 Gene:Spata6l / 381218 MGIID:1918036 Length:593 Species:Mus musculus


Alignment Length:248 Identity:65/248 - (26%)
Similarity:98/248 - (39%) Gaps:53/248 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 LTCPGVWLCSHGYLEATIKTLGYYFRTGPMEPRFPMLCHDQFTMEGYFKSV---GCLEEMHE--L 76
            ::||||:|.....:...:..|..|..|....|.||::..........|:..   |.:.|:.|  |
Mouse   206 ISCPGVFLPDKEAVYLGVYLLNQYLETDCFPPVFPVVIQQSMRFVKVFEEAIDPGAVAELLESFL 270

  Fly    77 LKAE--QLEITVWQNGRRLAYFVGSLSDVMQPTFPRLSCAH-SSNVQLLMKATPAFPGILAPKVE 138
            .:.|  ||....|:   .|||:..:..|.:.|. |||:.:| ....::|||....|||| |||:|
Mouse   271 TRFELVQLVSPAWE---ELAYYEKNTRDFLFPE-PRLASSHLGMQREVLMKTAIWFPGI-APKIE 330

  Fly   139 LSAQLTTQDRKKVCSCSSSREYSAPPVNRHV-ESRCLGHLDQPRKQQTV--CHGRQSNCCPSGSY 200
            .|.      |..:..|      ..|..||.: |.||       |.:::|  .||::..       
Mouse   331 FST------RTAILEC------VFPCKNRFICEERC-------RLERSVSKSHGQRVQ------- 369

  Fly   201 AAWRAGSPAQQKQQERRLSSCSSTTQLSSLSQSSSL-----TQCSHLSSCSSP 248
                 .:..::|.:|:........|| |.|.....|     ||.:|..|...|
Mouse   370 -----ATNRKKKPKEKDSDQLPKGTQ-SRLPSPQRLHLHRPTQRNHGKSFKFP 416

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14079NP_649091.1 SPATA6 10..144 CDD:291570 41/134 (31%)
Spata6lXP_011245574.3 SPATA6 206..337 CDD:373376 42/141 (30%)
LRIF1 <373..580 CDD:374067 12/45 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167834920
Domainoid 1 1.000 42 1.000 Domainoid score I12386
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1154886at2759
OrthoFinder 1 1.000 - - FOG0003962
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR16435
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5690
SonicParanoid 1 1.000 - - X7279
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
88.030

Return to query results.
Submit another query.