DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CNPYb and Cnpy3

DIOPT Version :9

Sequence 1:NP_649089.2 Gene:CNPYb / 40084 FlyBaseID:FBgn0036847 Length:221 Species:Drosophila melanogaster
Sequence 2:NP_082341.1 Gene:Cnpy3 / 72029 MGIID:1919279 Length:276 Species:Mus musculus


Alignment Length:207 Identity:99/207 - (47%)
Similarity:139/207 - (67%) Gaps:15/207 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 AGADSPEEEQGVRYANRCEACKILATELEARLGETGKSHDVIEIGYSVDDVKPKKRTEYRRSELR 83
            |||   ||...||..::||.||.:|.||::...||||:.:||:.||.:.|.| ....:|.:|:||
Mouse    35 AGA---EETDWVRLPSKCEVCKYVAVELKSAFEETGKTKEVIDTGYGILDGK-GSGVKYTKSDLR 95

  Fly    84 LLESLENVCERVLEYNLHKERSDSTRFAKGMSQTFQTLHGLVDKGVKVDLGIPYELWDKPPVEVT 148
            |:|..|.:|:|:|:|:|||||:.|.|||||||:||:|||.||.|||||.:.||||||::...||.
Mouse    96 LIEVTETICKRLLDYSLHKERTGSNRFAKGMSETFETLHNLVHKGVKVVMDIPYELWNETSAEVA 160

  Fly   149 QMKTQCENLLEEYEETISEWYFKHQDEKSLKKHLCEDHVLKKKAERECLKEQ-------LAPPEA 206
            .:|.||:.|:||:||.|.:||..||:| .|.:.||.:||||.| :..||.|:       :|....
Mouse   161 DLKKQCDVLVEEFEEVIEDWYRNHQEE-DLTEFLCANHVLKGK-DTSCLAERWSGKKGDIASLGG 223

  Fly   207 KKAKREKA--KG 216
            ||:|::::  ||
Mouse   224 KKSKKKRSGVKG 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CNPYbNP_649089.2 DUF3456 35..184 CDD:288766 77/148 (52%)
Cnpy3NP_082341.1 DUF3456 48..194 CDD:288766 76/147 (52%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 218..276 6/18 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4052
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1412562at2759
OrthoFinder 1 1.000 - - FOG0003994
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_105615
Panther 1 1.100 - - O PTHR15382
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3184
SonicParanoid 1 1.000 - - X2756
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
109.810

Return to query results.
Submit another query.