DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CNPYb and cnpy4

DIOPT Version :9

Sequence 1:NP_649089.2 Gene:CNPYb / 40084 FlyBaseID:FBgn0036847 Length:221 Species:Drosophila melanogaster
Sequence 2:NP_001034602.1 Gene:cnpy4 / 568776 ZFINID:ZDB-GENE-060315-5 Length:217 Species:Danio rerio


Alignment Length:207 Identity:97/207 - (46%)
Similarity:140/207 - (67%) Gaps:7/207 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 VTLWVVLQLAGADSPEEEQGVRYANRCEACKILATELEARLGETGKSHDVIEIGYSVDDVKPKKR 74
            |.|:.:..|..|:..|     |..|:||.||:|..||:..|.:||:|.:|:|:|..:|..|.:::
Zfish     6 VFLFYMFSLVLANQEE-----RLPNKCEVCKLLTVELQDALDKTGRSKEVVELGEVLDTGKRRRK 65

  Fly    75 TEYRRSELRLLESLENVCERVLEYNLHKERSDSTRFAKGMSQTFQTLHGLVDKGVKVDLGIPYEL 139
            .:|..||:||.|:::|:|||:|:|.:|.||..|.|:|||.|||..||..||:|||||:||:||||
Zfish    66 IKYNTSEMRLTEAMDNICERILQYKVHAERPGSLRYAKGTSQTMNTLKNLVEKGVKVELGVPYEL 130

  Fly   140 WDKPPVEVTQMKTQCENLLEEYEETISEWYFKHQDEKSLKKHLCEDHVLKKKAERECLKEQLAPP 204
            ||:|.|||.::|.|||.:|||:||.:.:|||.||| |.|::..||.||| |.:::|||.|.....
Zfish   131 WDEPTVEVAELKRQCETMLEEHEEVVEDWYFHHQD-KGLERFFCEAHVL-KDSDQECLTEIWKGD 193

  Fly   205 EAKKAKREKAKG 216
            ...|...|:::|
Zfish   194 MGMKGSEEESEG 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CNPYbNP_649089.2 DUF3456 35..184 CDD:288766 77/148 (52%)
cnpy4NP_001034602.1 DUF3456 26..174 CDD:288766 77/148 (52%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 194..217 3/12 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170580792
Domainoid 1 1.000 189 1.000 Domainoid score I3229
eggNOG 1 0.900 - - E1_KOG4052
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H15196
Inparanoid 1 1.050 201 1.000 Inparanoid score I3738
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1412562at2759
OrthoFinder 1 1.000 - - FOG0003994
OrthoInspector 1 1.000 - - oto40489
orthoMCL 1 0.900 - - OOG6_105615
Panther 1 1.100 - - LDO PTHR15382
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3184
SonicParanoid 1 1.000 - - X2756
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1615.790

Return to query results.
Submit another query.