DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CNPYb and CNPY4

DIOPT Version :9

Sequence 1:NP_649089.2 Gene:CNPYb / 40084 FlyBaseID:FBgn0036847 Length:221 Species:Drosophila melanogaster
Sequence 2:NP_689968.1 Gene:CNPY4 / 245812 HGNCID:28631 Length:248 Species:Homo sapiens


Alignment Length:221 Identity:108/221 - (48%)
Similarity:145/221 - (65%) Gaps:11/221 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 GFVTLWVVLQL--------AGADSPEEEQGVRYANRCEACKILATELEARLGETGKSHDVIEIGY 64
            |.|.|.::|.|        ||....|::...|..::||.||:|:|||:|.|..||:|.:|:|:|.
Human     2 GPVRLGILLFLFLAVHEAWAGMLKEEDDDTERLPSKCEVCKLLSTELQAELSRTGRSREVLELGQ 66

  Fly    65 SVDDVKPKKRTEYRRSELRLLESLENVCERVLEYNLHKERSDSTRFAKGMSQTFQTLHGLVDKGV 129
            .:|..|.|:...|..||.||.|:|||:|||:|:|::|.||..|.|:|||.|||..||.|||.|||
Human    67 VLDTGKRKRHVPYSVSETRLEEALENLCERILDYSVHAERKGSLRYAKGQSQTMATLKGLVQKGV 131

  Fly   130 KVDLGIPYELWDKPPVEVTQMKTQCENLLEEYEETISEWYFKHQDEKSLKKHLCEDHVLKKKAER 194
            |||||||.||||:|.||||.:|.|||.:|||:|:.:.:|||.|| |:.|:..|||.||| ..||.
Human   132 KVDLGIPLELWDEPSVEVTYLKKQCETMLEEFEDIVGDWYFHHQ-EQPLQNFLCEGHVL-PAAET 194

  Fly   195 ECLKEQLAPPEAKKAKREKAKGDKEE 220
            .||:|.....|....: ||.:|::|:
Human   195 ACLQETWTGKEITDGE-EKTEGEEEQ 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CNPYbNP_649089.2 DUF3456 35..184 CDD:288766 84/148 (57%)
CNPY4NP_689968.1 DUF3456 37..185 CDD:288766 84/148 (57%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 200..248 5/21 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165147271
Domainoid 1 1.000 187 1.000 Domainoid score I3345
eggNOG 1 0.900 - - E1_KOG4052
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H15196
Inparanoid 1 1.050 205 1.000 Inparanoid score I3734
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1412562at2759
OrthoFinder 1 1.000 - - FOG0003994
OrthoInspector 1 1.000 - - oto89678
orthoMCL 1 0.900 - - OOG6_105615
Panther 1 1.100 - - LDO PTHR15382
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3184
SonicParanoid 1 1.000 - - X2756
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1514.790

Return to query results.
Submit another query.