DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CNPYb and C11H1.7

DIOPT Version :9

Sequence 1:NP_649089.2 Gene:CNPYb / 40084 FlyBaseID:FBgn0036847 Length:221 Species:Drosophila melanogaster
Sequence 2:NP_001379119.1 Gene:C11H1.7 / 182526 WormBaseID:WBGene00007531 Length:176 Species:Caenorhabditis elegans


Alignment Length:172 Identity:56/172 - (32%)
Similarity:91/172 - (52%) Gaps:29/172 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 RCEACKILATELEARLGETGKSHDVIEIGYSVDDVKPKKRTEYRRSELRLLESLENVCERVLEYN 99
            :||.|.:.:.|.||:                  .||..||.....:::     .||:|....|:.
 Worm    29 KCEICALTSMEFEAK------------------SVKVHKRLSSEFADI-----TENICNGFNEFK 70

  Fly   100 LHKERSDSTRFAKGMSQTFQTLHGLVDKGVKVDLGIPYELWDKPPVEVTQMKTQCENLLEEYEET 164
            :|||::...||::..|:|.:||..:.:|||||:||:|:|:||:|..|:..::..||:|||:||:.
 Worm    71 IHKEKTGLERFSRAQSKTIETLKQMREKGVKVELGMPFEMWDQPSAEIFALRQGCESLLEDYEDL 135

  Fly   165 ISEWYFKHQDEKSLKKHLCEDHVLKKKAERECL-----KEQL 201
            |.||:......:.|.|.||..:.||.: |..|.     |::|
 Worm   136 IEEWFINKASLEDLFKQLCARNALKNQ-ETSCFDHLDHKQEL 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CNPYbNP_649089.2 DUF3456 35..184 CDD:288766 49/148 (33%)
C11H1.7NP_001379119.1 DUF3456 29..154 CDD:403222 48/147 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 99 1.000 Domainoid score I4462
eggNOG 1 0.900 - - E1_KOG4052
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 105 1.000 Inparanoid score I3520
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1412562at2759
OrthoFinder 1 1.000 - - FOG0003994
OrthoInspector 1 1.000 - - oto20786
orthoMCL 1 0.900 - - OOG6_105615
Panther 1 1.100 - - LDO PTHR15382
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3184
SonicParanoid 1 1.000 - - X2756
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1413.860

Return to query results.
Submit another query.