DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CNPYb and CNPY3

DIOPT Version :9

Sequence 1:NP_649089.2 Gene:CNPYb / 40084 FlyBaseID:FBgn0036847 Length:221 Species:Drosophila melanogaster
Sequence 2:NP_001305771.1 Gene:CNPY3 / 10695 HGNCID:11968 Length:311 Species:Homo sapiens


Alignment Length:243 Identity:101/243 - (41%)
Similarity:136/243 - (55%) Gaps:48/243 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 AGADSPEEEQGVRYANRCEACKILATELEARLGETGKSHDVIEIGYSVDDVK------------P 71
            |||   ||...||..::||.||.:|.||::...||||:.:||..||.:.|.|            |
Human    35 AGA---EENDWVRLPSKCEVCKYVAVELKSAFEETGKTKEVIGTGYGILDQKASGVKYTKSISDP 96

  Fly    72 KKRTEYRRS--------------------ELRLLESLENVCERVLEYNLHKERSDSTRFAKGMSQ 116
            ..:..|..|                    :|||:|..|.:|:|:|:|:|||||:.|.|||||||:
Human    97 PDQMTYLPSSSESLPIGGELSSSSSCLGRDLRLIEVTETICKRLLDYSLHKERTGSNRFAKGMSE 161

  Fly   117 TFQTLHGLVDKGVKVDLGIPYELWDKPPVEVTQMKTQCENLLEEYEETISEWYFKHQDEKSLKKH 181
            ||:|||.||.|||||.:.||||||::...||..:|.||:.|:||:||.|.:||..||:| .|.:.
Human   162 TFETLHNLVHKGVKVVMDIPYELWNETSAEVADLKKQCDVLVEEFEEVIEDWYRNHQEE-DLTEF 225

  Fly   182 LCEDHVLKKKAERECLKEQLAPPEA-----------KKAKREKAKGDK 218
            ||.:||||.| :..||.||.:..:.           ||:.|.||.|.:
Human   226 LCANHVLKGK-DTSCLAEQWSGKKGDTAALGGKKSKKKSSRAKAAGGR 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CNPYbNP_649089.2 DUF3456 35..184 CDD:288766 78/180 (43%)
CNPY3NP_001305771.1 DUF3456 48..227 CDD:288766 77/179 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4052
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1412562at2759
OrthoFinder 1 1.000 - - FOG0003994
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_105615
Panther 1 1.100 - - O PTHR15382
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3184
SonicParanoid 1 1.000 - - X2756
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
98.810

Return to query results.
Submit another query.