DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mkp3 and YVH1

DIOPT Version :9

Sequence 1:NP_001262031.1 Gene:Mkp3 / 40081 FlyBaseID:FBgn0036844 Length:497 Species:Drosophila melanogaster
Sequence 2:NP_012292.3 Gene:YVH1 / 854844 SGDID:S000001465 Length:364 Species:Saccharomyces cerevisiae


Alignment Length:273 Identity:74/273 - (27%)
Similarity:116/273 - (42%) Gaps:77/273 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   210 NYNEAPVEI--IPGLLFLGNATHSCDSEAL-KKYNIKYVLNVTPDLPNKFKESGDIKYL------ 265
            |.|....|:  |.|.::||......|...| .::||.::|:|.     ||:...:  ||      
Yeast     4 NANSVDEEVTRILGGIYLGGIRPIIDHRPLGAEFNITHILSVI-----KFQVIPE--YLIRKGYT 61

  Fly   266 --QIPITDHYSQDLAIHFPDAIQFIEEARSASSV-----------------VLVHCLAGVSRSVT 311
              .|||.|....|:..:|.:..:||::....:.|                 |..||.||:|||||
Yeast    62 LKNIPIDDDDVTDVLQYFDETNRFIDQCLFPNEVEYSPRLVDFKKKPQRGAVFAHCQAGLSRSVT 126

  Fly   312 VTLAYLMHTRGLSLNDAFAMVRDRKPDVSPNFHFMQQLLSFE--------------SQLRLRPGS 362
            ..:||||:..||||:.|...|:.:||.|.||.:||:||..||              .|.:|:...
Yeast   127 FIVAYLMYRYGLSLSMAMHAVKRKKPSVEPNENFMEQLHLFEKMGGDFVDFDNPAYKQWKLKQSI 191

  Fly   363 RFSCSCIAPDCNCMQTTGFMATHLANATGVSPD--SGIEFDRWTPSD----TGLKXEQSGGK--- 418
            :...|               .:.|.:.:|:..|  |..:.|:.|.::    |.:: ::...|   
Yeast   192 KLDPS---------------GSELVSNSGMFKDSESSQDLDKLTEAEKSKVTAVRCKKCRTKLAL 241

  Fly   419 --SFVL--PPSQE 427
              ||:.  |||:|
Yeast   242 STSFIAHDPPSKE 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mkp3NP_001262031.1 DSP_MapKP 8..148 CDD:238723
DSPc 215..353 CDD:238073 53/165 (32%)
CDC14 <242..359 CDD:225297 48/155 (31%)
YVH1NP_012292.3 DSP_fungal_YVH1 12..173 CDD:350368 54/167 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.