DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mkp3 and SDP1

DIOPT Version :9

Sequence 1:NP_001262031.1 Gene:Mkp3 / 40081 FlyBaseID:FBgn0036844 Length:497 Species:Drosophila melanogaster
Sequence 2:NP_012153.1 Gene:SDP1 / 854693 SGDID:S000001375 Length:209 Species:Saccharomyces cerevisiae


Alignment Length:157 Identity:40/157 - (25%)
Similarity:77/157 - (49%) Gaps:23/157 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   211 YNEAPVEIIPGLLFLGNATHSCDSEALKKYNIKY--VLNVTPDLPNKFKESGDIKYLQIPITD-- 271
            |.:.|:.::|..::|       .||...|..:.:  |:||.       :|:.|:: :|:|..:  
Yeast    56 YPKGPLLVLPEKIYL-------YSEPTVKELLPFDVVINVA-------EEANDLR-MQVPAVEYH 105

  Fly   272 HY----SQDLAIHFPDAIQFIEEARSASSVVLVHCLAGVSRSVTVTLAYLMHTRGLSLNDAFAMV 332
            ||    ...:|:..|.....|..|.:....:|:||..|:|||.|:.:||:|....|||..::.::
Yeast   106 HYRWEHDSQIALDLPSLTSIIHAATTKREKILIHCQCGLSRSATLIIAYIMKYHNLSLRHSYDLL 170

  Fly   333 RDRKPDVSPNFHFMQQLLSFESQLRLR 359
            :.|...::|:...:.||:.:|..|..:
Yeast   171 KSRADKINPSIGLIFQLMEWEVALNAK 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mkp3NP_001262031.1 DSP_MapKP 8..148 CDD:238723
DSPc 215..353 CDD:238073 37/145 (26%)
CDC14 <242..359 CDD:225297 33/124 (27%)
SDP1NP_012153.1 DSP_fungal_SDP1-like 56..194 CDD:350371 39/152 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 69 1.000 Domainoid score I2289
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm9172
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10159
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2281
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.040

Return to query results.
Submit another query.