DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mkp3 and PPS1

DIOPT Version :9

Sequence 1:NP_001262031.1 Gene:Mkp3 / 40081 FlyBaseID:FBgn0036844 Length:497 Species:Drosophila melanogaster
Sequence 2:NP_009835.3 Gene:PPS1 / 852579 SGDID:S000000480 Length:807 Species:Saccharomyces cerevisiae


Alignment Length:185 Identity:43/185 - (23%)
Similarity:67/185 - (36%) Gaps:55/185 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   223 LFLGNATHSCDSEALKKYNIKYVLNV--------------TPDLPNK------------------ 255
            |:||:..|:.:...||...|.::::|              .|..|::                  
Yeast   593 LYLGSLDHAQNPALLKSLGITHIVSVGEVVSWTLNKDKIAHPVRPHRAITMTNTNEVAGNTTCNK 657

  Fly   256 --------------------FKESGDIKYLQIPITDHYSQDLAIHFPD-AIQFIEEARSASSVVL 299
                                ..|:...:..||...|...:|...|..| .:.||..:.:....||
Yeast   658 SRNRADTVVSDKQENGSNVVISENSGFQICQIENLDDNGKDPLFHQIDKVLDFISNSEATGGKVL 722

  Fly   300 VHCLAGVSRSVTVTLAYLMHTRGLSLNDAFAMVRDRKPDV--SPNFHFMQQLLSF 352
            |||:.|||||.||.:|..|......|..|:..||.|:.:|  .||..|:.:|..:
Yeast   723 VHCMVGVSRSATVCIAECMRYLQCDLASAYLFVRVRRLNVIIQPNLFFVYELFKW 777

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mkp3NP_001262031.1 DSP_MapKP 8..148 CDD:238723
DSPc 215..353 CDD:238073 43/185 (23%)
CDC14 <242..359 CDD:225297 37/166 (22%)
PPS1NP_009835.3 DSP_fungal_PPS1 580..779 CDD:350366 43/185 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2281
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.