DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mkp3 and AT5G56610

DIOPT Version :10

Sequence 1:NP_001262031.1 Gene:Mkp3 / 40081 FlyBaseID:FBgn0036844 Length:497 Species:Drosophila melanogaster
Sequence 2:NP_200472.2 Gene:AT5G56610 / 835762 AraportID:AT5G56610 Length:228 Species:Arabidopsis thaliana


Alignment Length:121 Identity:33/121 - (27%)
Similarity:54/121 - (44%) Gaps:4/121 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   223 LFLGNATHSCDSEALKKYNIKYVLNVTPD----LPNKFKESGDIKYLQIPITDHYSQDLAIHFPD 283
            |.:|......|...|||..:..|:.:...    :|:....:.::::|.||..|:......:....
plant    74 LLMGAVPFRKDVPRLKKLGVGGVITLNEPYETLVPSSLYSAYEMEHLVIPTRDYLFAPSIVDITL 138

  Fly   284 AIQFIEEARSASSVVLVHCLAGVSRSVTVTLAYLMHTRGLSLNDAFAMVRDRKPDV 339
            |:.||.:.........|||.||..||.||.|.||:..:.:::..||..||..:|.|
plant   139 AVNFIHKNALLGKTTYVHCKAGRGRSTTVVLCYLIEHKSMTVAAAFEHVRSIRPRV 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mkp3NP_001262031.1 DSP_MapKP 8..148 CDD:238723
DSP_MKP_classII 215..352 CDD:350414 33/121 (27%)
AT5G56610NP_200472.2 PTPMT1 66..209 CDD:350374 33/121 (27%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.