DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mkp3 and DSPTP1

DIOPT Version :9

Sequence 1:NP_001262031.1 Gene:Mkp3 / 40081 FlyBaseID:FBgn0036844 Length:497 Species:Drosophila melanogaster
Sequence 2:NP_001189955.1 Gene:DSPTP1 / 821941 AraportID:AT3G23610 Length:228 Species:Arabidopsis thaliana


Alignment Length:186 Identity:56/186 - (30%)
Similarity:90/186 - (48%) Gaps:17/186 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   188 SSSAESSDCESSSHHHHHHSHHNYNEAPVEII-----------PGL----LFLGNATHSCDSEAL 237
            |.|:.||.........::....|..:|.|.:|           |.|    |:||:...:.:...|
plant     8 SPSSSSSSSSLPGIEKYNEKVKNQIQALVRVIKVARTYRDDNVPSLIEQGLYLGSVAAASNKNVL 72

  Fly   238 KKYNIKYVLNVTPDLPNKFKESGDIKYLQIPITDHYSQDLAIHFPDAIQFIEEARSASSVVLVHC 302
            |.||:.::|.|...|  :.....|..|..:.:.|....:|.::|.:.:.||:||:.....|||||
plant    73 KSYNVTHILTVASSL--RPAHPDDFVYKVVRVVDKEDTNLEMYFDECVDFIDEAKRQGGSVLVHC 135

  Fly   303 LAGVSRSVTVTLAYLMHTRGLSLNDAFAMVRDRKPDVSPNFHFMQQLLSFESQLRL 358
            ..|.|||||:.:||||...|::|..|...|:.::|..|||..|::||...|..:::
plant   136 FVGKSRSVTIVVAYLMKKHGMTLAQALQHVKSKRPVASPNAGFIRQLQDLEKSMQV 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mkp3NP_001262031.1 DSP_MapKP 8..148 CDD:238723
DSPc 215..353 CDD:238073 49/152 (32%)
CDC14 <242..359 CDD:225297 39/117 (33%)
DSPTP1NP_001189955.1 DSPc 51..186 CDD:238073 47/136 (35%)
CDC14 53..191 CDD:225297 47/139 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10159
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.