DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mkp3 and IBR5

DIOPT Version :9

Sequence 1:NP_001262031.1 Gene:Mkp3 / 40081 FlyBaseID:FBgn0036844 Length:497 Species:Drosophila melanogaster
Sequence 2:NP_178534.2 Gene:IBR5 / 814997 AraportID:AT2G04550 Length:257 Species:Arabidopsis thaliana


Alignment Length:273 Identity:69/273 - (25%)
Similarity:106/273 - (38%) Gaps:65/273 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   196 CESSSHHHHHHSHH---------------------NYNEAPVEIIPGLLFLGNATHSCDSEALKK 239
            |....|:|.:....                     :.:..|.||:|..|:||:..::..||.||.
plant    10 CSICGHYHKYEEGEVCGVCGHCMPVSSDTVAPQQVHVSAFPSEILPEFLYLGSYDNASRSELLKT 74

  Fly   240 YNIKYVLNVTPDLPNKFKESGDIKYLQIPITDH-YSQDLAIHFPDAIQFIEEARSASSVVLVHCL 303
            ..|..|||..|...|.::.|         .|.| ...:..:.|.|||:|:::.....:.|||||:
plant    75 QGISRVLNTVPMCQNLYRNS---------FTYHGLDNEKVLQFDDAIKFLDQCEKDKARVLVHCM 130

  Fly   304 AGVSRSVTVTLAYLMHTRGLSLNDAFAMVRDRKP--DVSPNFHFMQQLLSFESQLRLRPGSRFSC 366
            :|.|||..|.:||||..:|..|.::...|:.|:|  |:||.|:  |||..||.            
plant   131 SGKSRSPAVVVAYLMKRKGWRLAESHQWVKQRRPSTDISPEFY--QQLQEFEQ------------ 181

  Fly   367 SCIAPDCNCMQTTGFMATHLANATGV--SPDSGIEFDRWTPSDTGLKXEQSGGKSFVLPPSQEVP 429
                         |...:.:.:|..:  :|..|..|.:............:...|....|:..:|
plant   182 -------------GIFGSEMMSAMNINDAPTFGFGFPKIDNQAQAPVFNNAPTSSIFSSPASSIP 233

  Fly   430 ---FAAAATSPLP 439
               |...||.|.|
plant   234 PQEFTFGATPPKP 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mkp3NP_001262031.1 DSP_MapKP 8..148 CDD:238723
DSPc 215..353 CDD:238073 51/140 (36%)
CDC14 <242..359 CDD:225297 42/119 (35%)
IBR5NP_178534.2 DSPc 50..180 CDD:238073 51/140 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X468
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.