DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mkp3 and Dusp12

DIOPT Version :10

Sequence 1:NP_001262031.1 Gene:Mkp3 / 40081 FlyBaseID:FBgn0036844 Length:497 Species:Drosophila melanogaster
Sequence 2:NP_075662.2 Gene:Dusp12 / 80915 MGIID:1890614 Length:339 Species:Mus musculus


Alignment Length:174 Identity:59/174 - (33%)
Similarity:83/174 - (47%) Gaps:16/174 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   183 SDSACSSSAESSDCESSSHHHHHHSHHNYNEAPVEIIPGLLFLGNATHSCDSEALKKYNIKYVLN 247
            |:..|...|.::...||:.|            .||:.|| |:||.|....:...|::..|..||.
Mouse     7 SNHGCERQAPTASPASSAGH------------AVEVRPG-LYLGGAAAVAEPGHLREAGITAVLT 58

  Fly   248 V--TPDLPNKFKESGDIKYLQIPITDHYSQDLAIHFPDAIQFIEEARSASSVVLVHCLAGVSRSV 310
            |  .|..|......| ::.|.:|..|....||..|....:.||.:|||....|||||.|||||||
Mouse    59 VDSEPAFPAGAGFEG-LRSLFVPALDKPETDLLSHLDRCVAFIGQARSEGRAVLVHCHAGVSRSV 122

  Fly   311 TVTLAYLMHTRGLSLNDAFAMVRDRKPDVSPNFHFMQQLLSFES 354
            .|.:|::|.|..|:...|:.::|..||:...|..|..||..:|:
Mouse   123 AVVMAFIMKTDQLTFEKAYDILRTVKPEAKVNEGFEWQLKLYEA 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mkp3NP_001262031.1 DSP_MapKP 8..148 CDD:238723
DSP_MKP_classII 215..352 CDD:350414 52/138 (38%)
Dusp12NP_075662.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..25 5/17 (29%)
DSP_DUSP12 28..172 CDD:350370 53/141 (38%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.