DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mkp3 and Dusp18

DIOPT Version :10

Sequence 1:NP_001262031.1 Gene:Mkp3 / 40081 FlyBaseID:FBgn0036844 Length:497 Species:Drosophila melanogaster
Sequence 2:NP_776106.1 Gene:Dusp18 / 75219 MGIID:1922469 Length:188 Species:Mus musculus


Alignment Length:152 Identity:53/152 - (34%)
Similarity:75/152 - (49%) Gaps:12/152 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   215 PVEI----IPGL------LFLGNATHSCDSEALKKYNIKYVLNVTPDLPNKFKESGDIKYLQIPI 269
            ||:|    |.||      ||:.|...:.:...|....|..|:||:.::.|.|.|  ||:|:|:|:
Mouse     9 PVQIPQPSIRGLSQITKSLFISNGVAANNKLLLSSNQITTVINVSVEVANTFYE--DIQYVQVPV 71

  Fly   270 TDHYSQDLAIHFPDAIQFIEEARSASSVVLVHCLAGVSRSVTVTLAYLMHTRGLSLNDAFAMVRD 334
            .|.....|:..|......|..........|:||.||||||..:.|||||....:||.||....:.
Mouse    72 VDAPVARLSNFFDSVADRIHSVEMQKGRTLLHCAAGVSRSAALCLAYLMKYHAMSLVDAHTWTKS 136

  Fly   335 RKPDVSPNFHFMQQLLSFESQL 356
            .:|.:.||..|.:||:.:|.||
Mouse   137 CRPIIRPNSGFWEQLIHYELQL 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mkp3NP_001262031.1 DSP_MapKP 8..148 CDD:238723
DSP_MKP_classII 215..352 CDD:350414 50/146 (34%)
Dusp18NP_776106.1 PTP_DSP_cys 19..176 CDD:475123 49/142 (35%)
Sufficient for mitochondrial localization 95..141 19/45 (42%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.