DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mkp3 and Dusp18

DIOPT Version :9

Sequence 1:NP_001262031.1 Gene:Mkp3 / 40081 FlyBaseID:FBgn0036844 Length:497 Species:Drosophila melanogaster
Sequence 2:NP_776106.1 Gene:Dusp18 / 75219 MGIID:1922469 Length:188 Species:Mus musculus


Alignment Length:152 Identity:53/152 - (34%)
Similarity:75/152 - (49%) Gaps:12/152 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   215 PVEI----IPGL------LFLGNATHSCDSEALKKYNIKYVLNVTPDLPNKFKESGDIKYLQIPI 269
            ||:|    |.||      ||:.|...:.:...|....|..|:||:.::.|.|.|  ||:|:|:|:
Mouse     9 PVQIPQPSIRGLSQITKSLFISNGVAANNKLLLSSNQITTVINVSVEVANTFYE--DIQYVQVPV 71

  Fly   270 TDHYSQDLAIHFPDAIQFIEEARSASSVVLVHCLAGVSRSVTVTLAYLMHTRGLSLNDAFAMVRD 334
            .|.....|:..|......|..........|:||.||||||..:.|||||....:||.||....:.
Mouse    72 VDAPVARLSNFFDSVADRIHSVEMQKGRTLLHCAAGVSRSAALCLAYLMKYHAMSLVDAHTWTKS 136

  Fly   335 RKPDVSPNFHFMQQLLSFESQL 356
            .:|.:.||..|.:||:.:|.||
Mouse   137 CRPIIRPNSGFWEQLIHYELQL 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mkp3NP_001262031.1 DSP_MapKP 8..148 CDD:238723
DSPc 215..353 CDD:238073 50/147 (34%)
CDC14 <242..359 CDD:225297 43/115 (37%)
Dusp18NP_776106.1 PTP_DSP_cys 19..176 CDD:391942 49/142 (35%)
Sufficient for mitochondrial localization 95..141 19/45 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2281
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.