DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mkp3 and STYX

DIOPT Version :10

Sequence 1:NP_001262031.1 Gene:Mkp3 / 40081 FlyBaseID:FBgn0036844 Length:497 Species:Drosophila melanogaster
Sequence 2:NP_660294.1 Gene:STYX / 6815 HGNCID:11447 Length:223 Species:Homo sapiens


Alignment Length:146 Identity:49/146 - (33%)
Similarity:84/146 - (57%) Gaps:12/146 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   217 EIIPGLLFLGNATHSCDSE--ALKKYNIKYVLNVTPDL------PNKFKESGDIKYLQIPITDHY 273
            ||:|| ||||..:.:..|:  .|:|:.|.:::.:..::      || |::.  .:||.:.|.|:.
Human    31 EILPG-LFLGPYSSAMKSKLPVLQKHGITHIICIRQNIEANFIKPN-FQQL--FRYLVLDIADNP 91

  Fly   274 SQDLAIHFPDAIQFIEEARSASSVVLVHCLAGVSRSVTVTLAYLMHTRGLSLNDAFAMVRDRKPD 338
            .:::...||...:||:.:......||||..||:|||....:||:|.|.|:...||||.|::|:..
Human    92 VENIIRFFPMTKEFIDGSLQMGGKVLVHGNAGISRSAAFVIAYIMETFGMKYRDAFAYVQERRFC 156

  Fly   339 VSPNFHFMQQLLSFES 354
            ::||..|:.||..:|:
Human   157 INPNAGFVHQLQEYEA 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mkp3NP_001262031.1 DSP_MapKP 8..148 CDD:238723
DSP_MKP_classII 215..352 CDD:350414 48/142 (34%)
STYXNP_660294.1 DSP_STYX 25..175 CDD:350372 49/146 (34%)
Interaction with FBXW7. /evidence=ECO:0000269|PubMed:28007894 76..78 1/1 (100%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 197..223
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.