DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mkp3 and Dusp19

DIOPT Version :10

Sequence 1:NP_001262031.1 Gene:Mkp3 / 40081 FlyBaseID:FBgn0036844 Length:497 Species:Drosophila melanogaster
Sequence 2:NP_077758.1 Gene:Dusp19 / 68082 MGIID:1915332 Length:220 Species:Mus musculus


Alignment Length:138 Identity:46/138 - (33%)
Similarity:79/138 - (57%) Gaps:2/138 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   216 VEIIPGLLFLGNATHSCDSEALKKYNIKYVLNVTPDLPNKFKESGDIKYLQIPITDHYSQDLAIH 280
            |.:|...|.||:...:.|.|.|:|:.:.::|||...:.|.|  ..:..|..|.|.|....::..:
Mouse    65 VGVIKPWLLLGSQDAAHDLELLRKHKVTHILNVAYGVENAF--LSEFTYKTISILDVPETNILSY 127

  Fly   281 FPDAIQFIEEARSASSVVLVHCLAGVSRSVTVTLAYLMHTRGLSLNDAFAMVRDRKPDVSPNFHF 345
            ||:..:|||:|:....||||||.|||||:..:.:.:||.:...:...|.::|::.:|.:.||..|
Mouse   128 FPECFEFIEQAKLKDGVVLVHCNAGVSRAAAIVIGFLMSSEEATFTTALSLVKEARPSICPNPGF 192

  Fly   346 MQQLLSFE 353
            |:||.:::
Mouse   193 MEQLRTYQ 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mkp3NP_001262031.1 DSP_MapKP 8..148 CDD:238723
DSP_MKP_classII 215..352 CDD:350414 46/135 (34%)
Dusp19NP_077758.1 DSP_DUSP19 64..200 CDD:350373 46/136 (34%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.