DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mkp3 and dusp12

DIOPT Version :10

Sequence 1:NP_001262031.1 Gene:Mkp3 / 40081 FlyBaseID:FBgn0036844 Length:497 Species:Drosophila melanogaster
Sequence 2:NP_001020348.1 Gene:dusp12 / 573998 ZFINID:ZDB-GENE-050626-91 Length:305 Species:Danio rerio


Alignment Length:142 Identity:48/142 - (33%)
Similarity:69/142 - (48%) Gaps:21/142 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   223 LFLGNATHSCDSEALKKYNIKYVLNVTPD------LPNKFKESGDIKYLQIPITDHYSQDLAIHF 281
            |::|:.:...|:|:|....|.::|.|..:      ...||          |...|..|.||....
Zfish     8 LYIGSVSDLKDAESLSAAGITHILTVDSEEASVTGFNTKF----------IRALDDESTDLLSRL 62

  Fly   282 PDAIQFIEEARSA-----SSVVLVHCLAGVSRSVTVTLAYLMHTRGLSLNDAFAMVRDRKPDVSP 341
            .|...||.||.|.     |:.|||||..|.|||..|..||||.|:.|:|.:|::.:::.||||..
Zfish    63 DDCTSFISEALSTQADSKSAAVLVHCHVGQSRSAAVVTAYLMKTQHLTLQEAYSKLQNIKPDVKM 127

  Fly   342 NFHFMQQLLSFE 353
            |..|:.||..::
Zfish   128 NEEFLDQLALYD 139

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mkp3NP_001262031.1 DSP_MapKP 8..148 CDD:238723
DSP_MKP_classII 215..352 CDD:350414 48/139 (35%)
dusp12NP_001020348.1 DSP_DUSP12 1..146 CDD:350370 48/142 (34%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.